KEGG   Pan troglodytes (chimpanzee): 746537
Entry
746537            CDS       T01005                                 

Gene name
NPAS1
Definition
(RefSeq) neuronal PAS domain-containing protein 1 isoform X2
  KO
K09098  neuronal PAS domain-containing protein 1/3
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    746537 (NPAS1)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    746537 (NPAS1)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_4
Other DBs
NCBI-GeneID: 746537
NCBI-ProteinID: XP_001168613
Ensembl: ENSPTRG00000011199
VGNC: 2301
UniProt: A0A6D2WT08 H2QGN8
Position
19
AA seq 590 aa
MAAPYPGSGGGSEVKCVGGRGASVPWDFLPGLMVKAPSGPCLQAQRKEKSRNAARSRRGK
ENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAAGPPAGLA
PGRRGPAALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVEMTGS
SVFDYIHPGDHSEVLEQLGLRTPTPGPPTPPSVSSSSSSSSSLADTPEIEASLTKVPPSS
LVQERSFFVRMKSTLTKRGLHVKASGYKVIHVTGRLRAHALGLVALGHTLPPAPLAELPL
HGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDATRIRQSHVDLLDK
GQVMTGYYRWLQRAGGFVWLQSVATVAGSGKSPGEHHVLWVSHVLSQAEGGQTPLDAFQL
PASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGKRIKVEPGPRETKGSEDSGD
EDPSGHPATPRPEFTSVIRAGVLKQDPVRPWGLAPPGDPPPTLLHAGFLPPVVRGLCTPG
TIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGTRLPRKGD
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggcggccccctatcccggcagtggcggcggaagcgaggtcaaatgcgtgggaggccgc
ggcgccagcgtcccctgggactttctacccgggctgatggtcaaggcgccgtccggaccg
tgcctgcaggcgcagcgcaaggagaagtcccggaacgcggcgcgctcgcggcgcgggaag
gagaacctggagttcttcgagctggccaagcttctcccgctgcccggcgccatctccagc
cagctggacaaggcttccatcgtgcgcctcagcgtcacctacctccgcctgcgccggttc
gccgcgctgggggcgccgccctgggggctgagagccgcggggccgccagctggcctcgcc
ccaggccgccgcggccccgcagcgctggtctccgaagtcttcgagcagcacctgggaggt
cacatcttgcagtccctggatggctttgtgttcgccttgaaccaggaaggaaaattcctc
tacatctcagagacagtctccatctatctgggtctctcacaggtggagatgacgggcagc
agcgtcttcgactacattcaccctggggaccactcagaggtgctggagcaactggggctg
cggacgccgacgcccggccccccaaccccgccctccgtctcctcttcctcctcctcttcc
tcttcgcttgcagatacccccgagatcgaggccagcctcaccaaggtgcccccctcctcc
ctggtccaggagcgctccttctttgtccgcatgaaatccacgctcaccaagagggggctg
cacgtcaaggcctcagggtacaaggtcatccacgtgactgggcgccttcgggcccacgcc
ctgggccttgtggccctcgggcacacgttgcccccggcccccctggctgagctgccactc
cacggacacatgatcgtcttccgtctcagcctgggtctcaccatccttgcttgtgagagc
agagtcagcgaccacatggacctggggccctcagagctggtgggccgcagctgctaccag
tttgtccacggacaggacgccacgaggatccgccagagccacgtggacttgctggacaag
ggtcaggtgatgactggttactaccgttggctgcagcgtgccgggggcttcgtgtggctg
cagtctgtggccacggtggctgggagcgggaagagccccggggagcaccatgtgctttgg
gtcagccacgtgctcagccaagccgagggtggccaaactcctttggatgccttccagctt
ccagccagcgtggcctgtgaggaggcatccagcccggggccagagcccacagagccggag
cctccgacggaagggaagcaggctgccccagcggagaacgaggccccccagacccagggc
aaacgcatcaaagtggagcccggcccgagggaaaccaaaggctccgaggacagtggcgac
gaggatccctccggccacccggccacaccacggcccgagttcacctctgtcatccgggca
ggggtcctgaagcaggacccggtgcggccatggggcctggcgcctcccggggaccccccg
cccaccctcctgcacgcgggcttcttgccgccggtggtgcggggcctgtgcacgcccggc
accatccgctacggccccgcggagctgggcctggtgtacccgcacctgcagaggctgggt
ccgggccccgcgctcccggaggccttttacccgcccctgggcctgccctacccggggccc
gcgggcaccaggctgccgcggaagggggactga

DBGET integrated database retrieval system