KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108515938
Entry
108515938         CDS       T04641                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04080  Neuroactive ligand-receptor interaction
rbb04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108515938 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108515938 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 108515938
NCBI-ProteinID: XP_017708606
UniProt: A0A2K6KLP8
Position
Un
AA seq 77 aa
MNLRLCVQALLLLWLSLTAVCGGPLMRLPYGNGLEEGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctctgcgtgcaggctctcctgctcctctggctctccttgaccgcagtg
tgtggagggcccctgatgcggcttccctatgggaatgggctggaagagggcaatgtccgc
cacctggtgcagcccagagggtcgaggaacgggccagggccctggcagggaggtcggagg
aaattccgccgccagcggccccgcctctcccataagggacccatgcctttctga

DBGET integrated database retrieval system