KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108527211
Entry
108527211         CDS       T04641                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108527211 (AHRR)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    108527211 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_4 PAS_3 PAS_9
Other DBs
NCBI-GeneID: 108527211
NCBI-ProteinID: XP_017723846
Position
Un
AA seq 697 aa
MIPPGECTYAGRKRRRPLQKQRPAMGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPRDSRPLAGSAVLEGRLLLESLN
GFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQV
VFGQPPPLETGDDAILGRLLRAQEWGAGAPTEYSAFLTRCFICRVRCLLDSTSGFLMMQF
QGKLKFLFGQKKKAPSGAVLPPRLSLFCIVAPVLLPSTAEMKMRSALLRAKPRADTTATT
DAKVKANTSLCESELHGKPNYSAGRSGRESGVLVLREHTDAGRWAQVPTRAPCLCLRGGP
DLVLDPKGCSGDREEEQHRMLSRASGVTGHRETPGPTKPLPWTAGRHSEDGARLRLQPSK
SDPPGLRPTPRGSCLPYSCVQGTLRNSPISHPPSPSPSAYSSRTSRPVRDVGEDQVHPPL
CHFPQGSLQHRLPQPGAQRCATRGYPMEDVKLQGVPMPPGDLCGPTLLLDVPIKMEKDSG
SEDAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYLSHLGHGMRGTQPHGRA
TVGRSRELTPFHPAHCASLEPVHGLSQPEPSHQLCVRGRGEQSCACRAAEAAPVVKREPL
DSPQWATHSQGVVPGMFPKSALATLVPPQASECTFLP
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgatcccgcccggggagtgcacgtacgcgggccggaagcggaggaggcccctgcagaaa
cagaggcccgccatgggggcagagaagtccaacccctccaagcggcaccgggaccgcctc
aacgccgagttggaccacctggccagcctgctgccgttcccacctgacatcatctccaag
ctggacaagctttctgtcctgcgtctcagtgtcagttacctccgggtgaagagcttcttc
caagtcgtgcaggagcagagctcacggcagccggcggccggtgccccctcgcccagagac
agtcgtcctcttgcagggtctgccgtgctggagggaaggctgctgctggagtctcttaat
ggctttgctctggtcgtgagtgcagaagggacaatattttatgcgtcagcaacgatcgtg
gactatctgggcttccatcagacagacgtgatgcaccagaacatttacgactacatccac
gtggacgaccgccaggacttctgccggcagctccactgggccatggaccctccccaggtg
gtgtttgggcagcccccgcccttggagacaggagatgacgccatcctggggaggctgctc
agggcccaggagtggggcgcaggcgcgcccaccgagtactcagccttcctgacccgctgc
ttcatctgccgtgtgcgctgcctgctggacagcacctcgggcttcctgatgatgcagttt
caaggaaaactgaaattcctgtttggacagaagaagaaggcgccgtccggagccgtgctc
ccgccgcgactgtcgctgttctgcattgtggcacccgttctcctcccctccacagcggag
atgaaaatgaggagtgcgcttctgagggcaaagcccagggcagacaccacggccaccaca
gatgcaaaagtaaaagccaacaccagcctgtgcgaatcggaactgcatggaaaacccaat
tactcagcaggaaggagcggcagagaaagcggcgttttggtgctcagggaacacactgac
gctggccgatgggcacaggttcccaccagggccccgtgcctgtgcctccggggcggcccc
gaccttgtcctcgaccccaaggggtgctcaggggacagggaggaggagcagcacaggatg
ctgagcagggcctccggagtgacagggcacagggagactccaggacccacgaagcccctg
ccctggacagcgggaaggcacagtgaggatggcgccaggctgaggctgcagcccagcaag
agtgacccacccggcctgcgccccacgccccgcggctcctgcctgccctattcgtgtgtc
cagggcactttgaggaactcgcccatctctcacccgccgagcccatcccccagtgcctac
tccagccggaccagcagacctgtgcgggatgtcggtgaggaccaggtgcaccctcccctc
tgccactttccccaggggagcctgcagcaccggctccctcagcctggagctcagcgttgt
gccacgaggggctatcccatggaggacgtgaagctgcagggtgtgccgatgcctccaggg
gacctgtgcggtccgacgctgctgctagatgtgcccatcaagatggagaaggactctggg
tctgaggatgctgcagacggctgtgtgcccagccaggtgtggctgggggccagtgacagg
agccatccagccaccttccctaccaggatgcacctgaaaacagagcctgactctcggcaa
caggtgtacctctcgcacctggggcatggcatgcgggggactcagcctcatggcagggcc
actgttggacgcagcagggagctgacccctttccaccccgcacactgtgcctccctggag
cccgtgcatggcctttcccagccagagccttcccaccagctctgtgtacggggccgaggt
gaacagtcctgcgcctgcagagctgctgaggccgcccctgtggtcaagcgggagcccctg
gattcgccccagtgggcgactcacagccagggagtggtgcctgggatgtttcccaaaagt
gccttggcgacgctggtcccaccccaagcttcagagtgcacattcctgccgtag

DBGET integrated database retrieval system