KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000907
Entry
RHECIAT_PC0000907 CDS       T00720                                 

Gene name
virB5c
Definition
(GenBank) transport secretion system IV protein, VirB5
  KO
K03200  type IV secretion system protein VirB5
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rec00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RHECIAT_PC0000907 (virB5c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rec02044]
    RHECIAT_PC0000907 (virB5c)
Secretion system [BR:rec02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   RHECIAT_PC0000907 (virB5c)
SSDB
Motif
Pfam: T4SS NPV_P10 FAM180 Lzipper-MIP1 THOC7 DUF4140
Other DBs
NCBI-ProteinID: ACE94977
UniProt: B3Q3W7
Position
pC:complement(996061..996762)
AA seq 233 aa
MIRTGTMRPLSVSAALLASAMLASAQGIPVIDQTSIAKQIESITQLKSQLDALNQQLQQA
QQLYGSLNKITNMADIASLLNDPSIRKALPQDFNAIEGLFKGSGSGVFGNSASKFLQDNS
TYRTDADDFYARELSRIQNQNAGQMSLGQQIYDAATKRIDGIDELRQKISSAADAKDIAD
LQARLQAETAFLQTDLLRMQGLQMVQQAQVQVDEQRKAEDWRKRMDTMGAALK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgatccgaacaggaacgatgcgcccattgtctgtatctgccgctcttttggcgtcggcg
atgctggcatcggcccagggcatcccggtcatcgatcagacatcgatcgccaagcagatc
gaaagcatcacgcagctgaagtcccagctcgacgccttgaaccagcagctccagcaagcc
cagcagctctatggatcgctgaacaagatcaccaatatggccgacatcgccagcctgctg
aacgatccgtcgatccgcaaggcgctgccgcaggacttcaacgcgatcgaggggctgttc
aaaggttccggcagcggcgtcttcggcaattccgcttcgaaattcctgcaggacaattcc
acctatcgcaccgatgccgacgatttctatgcgcgggagctgtcgcgcatccagaaccag
aacgccgggcagatgagcttgggacagcagatctacgatgccgcgaccaagcgcatcgac
ggtatcgacgagcttcgccagaagatctcaagtgcggccgacgcaaaggacattgccgac
cttcaagcgcgcctgcaggccgaaaccgccttcctgcaaaccgacctcctgcgcatgcag
ggcctgcagatggtccagcaggcccaggtgcaggtcgatgagcagcgcaaggccgaggat
tggcgcaagcgcatggacacgatgggagcggcactcaaatga

DBGET integrated database retrieval system