GenomeNet

Database: RefSeq
Entry: NC_007260
LinkDB: NC_007260
Original site: NC_007260 
LOCUS       NC_007260             702208 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 19.
ACCESSION   NC_007260 CT005258
VERSION     NC_007260.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 702208)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 702208)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796415.
            On Jun 1, 2012 this sequence version replaced NC_007260.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..702208
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="19"
     gene            complement(<1553..>2440)
                     /locus_tag="LMJF_19_0010"
                     /db_xref="GeneID:5651277"
     mRNA            complement(<1553..>2440)
                     /locus_tag="LMJF_19_0010"
                     /product="putative Qb-SNARE protein"
                     /transcript_id="XM_001682526.1"
                     /db_xref="GeneID:5651277"
     CDS             complement(1553..2440)
                     /locus_tag="LMJF_19_0010"
                     /codon_start=1
                     /product="putative Qb-SNARE protein"
                     /protein_id="XP_001682578.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651277"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:Q4QDM0"
                     /translation="MAGAKDERENRDISTDPFQDLTNNFVRAATRAKNNINERNNGCR
                     QHGQDHMAIVQSNEIRKDLRLMEETLEEIHKLVLEAERRLAKENKKKKPKESKINLLE
                     RDYEGRRSQYDNCVSAIQNLKEMEAQRVEVARTEINTVQEMQFGKRAQLRQQLLGMRR
                     KDNGSGETVGPGDVELVDSTVGGGTLQEHEESKEQMKMIAAQDAKIDAGLCRIKEGVG
                     RLHDLAVQIGAQIDMQNAMLDETEQVIDKDTAQLRGLNRRLKTFLKETRPMNCFLYVC
                     CVFLIVALTGFFLVQFNVI"
     gene            complement(<3727..>4497)
                     /locus_tag="LMJF_19_0020"
                     /db_xref="GeneID:5651106"
     mRNA            complement(<3727..>4497)
                     /locus_tag="LMJF_19_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682527.1"
                     /db_xref="GeneID:5651106"
     CDS             complement(3727..4497)
                     /locus_tag="LMJF_19_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682579.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651106"
                     /db_xref="UniProtKB/TrEMBL:Q4QDL9"
                     /translation="MVRQRTSAGAGIHATKETPSPQKGAQSHVQTPPPPELPQSQPES
                     VQPSAPAQPEESSEEEVVVNTVQAPAVVEMEPIPEPPAPVALVIAPHYVLEIERVVSV
                     KLPPRVTQTAETQRGLYMFSAQAGKPPTPPPTVQQHAVYRPDTANLGTRQWSLGTDSR
                     IQQPPQQQHAWPSASQFDYWNNAPERVQASRPFMGTQAQAPYNSYPSAAPLAHQRATG
                     NAFPVRFRSSEVPESALRQQSAVPFNRASQPTNGGGVW"
     gene            complement(<5559..>5882)
                     /locus_tag="LMJF_19_0030"
                     /db_xref="GeneID:5651107"
     mRNA            complement(<5559..>5882)
                     /locus_tag="LMJF_19_0030"
                     /product="histone H2B"
                     /transcript_id="XM_001682528.1"
                     /db_xref="GeneID:5651107"
     CDS             complement(5559..5882)
                     /locus_tag="LMJF_19_0030"
                     /codon_start=1
                     /product="histone H2B"
                     /protein_id="XP_001682580.1"
                     /db_xref="GeneID:5651107"
                     /db_xref="GOA:Q4QDL6"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QDL6"
                     /translation="MASSRKASNPHKSHRKPKRSWNVYVGRSLKAINAQMSMSHRTMK
                     IVNSYVNDVMERICTEAASIVRANKKRTLGAREVQTAVRIVLPAELAKHAMAEGTKAV
                     SSASR"
     gene            complement(<6427..>6750)
                     /locus_tag="LMJF_19_0040"
                     /db_xref="GeneID:5651108"
     mRNA            complement(<6427..>6750)
                     /locus_tag="LMJF_19_0040"
                     /product="histone H2B"
                     /transcript_id="XM_001682529.1"
                     /db_xref="GeneID:5651108"
     CDS             complement(6427..6750)
                     /locus_tag="LMJF_19_0040"
                     /codon_start=1
                     /product="histone H2B"
                     /protein_id="XP_001682581.1"
                     /db_xref="GeneID:5651108"
                     /db_xref="GOA:Q4QDL6"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QDL6"
                     /translation="MASSRKASNPHKSHRKPKRSWNVYVGRSLKAINAQMSMSHRTMK
                     IVNSYVNDVMERICTEAASIVRANKKRTLGAREVQTAVRIVLPAELAKHAMAEGTKAV
                     SSASR"
     gene            complement(<7295..>7618)
                     /locus_tag="LMJF_19_0050"
                     /db_xref="GeneID:5651109"
     mRNA            complement(<7295..>7618)
                     /locus_tag="LMJF_19_0050"
                     /product="histone H2B"
                     /transcript_id="XM_001682530.1"
                     /db_xref="GeneID:5651109"
     CDS             complement(7295..7618)
                     /locus_tag="LMJF_19_0050"
                     /codon_start=1
                     /product="histone H2B"
                     /protein_id="XP_001682582.1"
                     /db_xref="GeneID:5651109"
                     /db_xref="GOA:Q4QDL6"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QDL6"
                     /translation="MASSRKASNPHKSHRKPKRSWNVYVGRSLKAINAQMSMSHRTMK
                     IVNSYVNDVMERICTEAASIVRANKKRTLGAREVQTAVRIVLPAELAKHAMAEGTKAV
                     SSASR"
     gene            complement(<8204..>9001)
                     /locus_tag="LMJF_19_0060"
                     /db_xref="GeneID:5651110"
     mRNA            complement(<8204..>9001)
                     /locus_tag="LMJF_19_0060"
                     /product="40S ribosomal protein S2"
                     /transcript_id="XM_001682531.1"
                     /db_xref="GeneID:5651110"
     CDS             complement(8204..9001)
                     /locus_tag="LMJF_19_0060"
                     /codon_start=1
                     /product="40S ribosomal protein S2"
                     /protein_id="XP_001682583.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651110"
                     /db_xref="GOA:Q4QDL5"
                     /db_xref="InterPro:IPR000851"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR005711"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018192"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q4QDL5"
                     /translation="MADTQPAQEAPATDAPRAERNFGRGRGGRGGRGRGRGGPGEEKE
                     WVPCTKLGRLVKAQKVTSLEEIFLFSMPIKEHQIVDTLIAEGQLHDEMMKIYPVQKAT
                     SAGQRTRFKAFNVVGDCDGHIGIGARVGKEVSLAIRASMIAAKLNIVPVRRGYWGNKI
                     GEPHTIPMKVTGKCGSVAVRLVPAPRGTGIVAAPVPKKILEFAGVEDVYTSSRGKTRT
                     HGNLIMATFYALRKTYGFLTPDLWADTEPSRDPTDEHAELLAEMTTA"
     gene            complement(<10647..>12047)
                     /gene="PEX13"
                     /locus_tag="LMJF_19_0070"
                     /db_xref="GeneID:5651111"
     mRNA            complement(<10647..>12047)
                     /gene="PEX13"
                     /locus_tag="LMJF_19_0070"
                     /product="putative peroxin 13"
                     /transcript_id="XM_001682532.1"
                     /db_xref="GeneID:5651111"
     CDS             complement(10647..12047)
                     /gene="PEX13"
                     /locus_tag="LMJF_19_0070"
                     /codon_start=1
                     /product="putative peroxin 13"
                     /protein_id="XP_001682584.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651111"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:Q4QDL4"
                     /translation="MISLRRSSSLLVEEWKSIVAPVCYASLEFFVVSSTFSLIRPFIM
                     FSGMYGGGLGGMGSAMYGGGLGGMGGMYGGGLGGMSGMYGNSGLMGGSSYAMSGGLNS
                     FVRNNPYGSNSNYSVGGFNSLGSNADGTQNNGMQSSINLQQQADQSNHLASPIHQHAA
                     TLPPLNESPEERSRRIQAEHKKERQLIRQQREQHRQARLQARMEIVGHLTNVLVQGLR
                     SAMELFGVCFGTYYSMKAVRAFSSAQERMPSMGMGMGANYPYGAAVAKTQAVATGASG
                     VQQVAKAASGGSSKWRAWLLCIAFFLLGEVVYGIATRQRAKLPQRRRRITGPAEDAYG
                     NVLSQDEYEVSIRSSDAESRLTEGDKGEEETLSEAWGQAYNANGVCGVSQAARPSGGN
                     GTRRVYYALYDYQAPQADGSCLSFKAGDEFVVENYAEGSWCEAMAVEGGSYSSHGRRG
                     LVPSNFLRLAERITKL"
     gene            complement(<12937..>14235)
                     /locus_tag="LMJF_19_0080"
                     /db_xref="GeneID:5651112"
     mRNA            complement(<12937..>14235)
                     /locus_tag="LMJF_19_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682533.1"
                     /db_xref="GeneID:5651112"
     CDS             complement(12937..14235)
                     /locus_tag="LMJF_19_0080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682585.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651112"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q4QDL3"
                     /translation="MDKQDYYTILGISRTANKDAIRQAYKLKALQLHPDKNPNGEAIF
                     KLVVNAYQTLNDPTKRSAYDRELTRRDRGFGAHPFRQAAPQPSSPAAYPSSSYGADAG
                     ASRKPRYATDEQLFKDAYEQYKKSPFSATPDGGFRGLNSEGTFAEWFKKKQEELRRAE
                     EVTKAKAEYAKNLEREEKRRVEEWRDMQRRREEEREEEVRLAKDQREREREMLRRKRE
                     AEAKEQKAAEKKAQMEAYAEVQREQQADVERHLRDLASQKRELAEERRRLAEERAEVT
                     NLAAEHRFTRDMANKQRGQELADAVRRADAKVREAQEQQMLREVHERAKAEERAREEK
                     LKRAEEERALEAEKARERQRQKEAEAAEQERNRTTAELGEQRKRVIAQMMSERRRHEE
                     EVSAMRRETDRIEAEMKAKLEALRAAKNAGQTINLDEWKL"
     gene            complement(<15073..>16284)
                     /locus_tag="LMJF_19_0090"
                     /db_xref="GeneID:5651113"
     mRNA            complement(<15073..>16284)
                     /locus_tag="LMJF_19_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682534.1"
                     /db_xref="GeneID:5651113"
     CDS             complement(15073..16284)
                     /locus_tag="LMJF_19_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682586.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651113"
                     /db_xref="UniProtKB/TrEMBL:Q4QDL2"
                     /translation="MKPKAAQVRQQQSLNRRVKLEESAARVQQDILARQAAMRNMGGE
                     QHRYPMYGYAGHPARNRDPNRGVITQTEWSELVERHEDSGKCFRYFFGVLIIAAILLL
                     TISKYDEEYNLEVPQVESGKGFGEVLNPERAVDAKELESYYHTLGVEGRLNLTRKTAS
                     PATDASEEKPSSRKAADDPDKARRRENYQVRQQIKRAFQDHQEKYGQLVHCGRTCEAQ
                     NKQVELAYQKLTSQVDRELFGVLLDAKNTKSVRSTTPAQLKAKYEEKRQKIFETEEDE
                     EDRNMALEELKDAYEIIENPDARKYYLLYGAKPPEHMRHVSARHGGWGQEMALGTFKY
                     RIIIMWLEFLHQYIGVWGETAVLGCVVLFMLSRLPQALKDSQRLLDELDLQDEHAEEE
                     KRAAEQQVQRE"
     gene            complement(<18120..>19013)
                     /locus_tag="LMJF_19_0100"
                     /db_xref="GeneID:5651101"
     mRNA            complement(<18120..>19013)
                     /locus_tag="LMJF_19_0100"
                     /product="putative fibrillarin"
                     /transcript_id="XM_001682535.1"
                     /db_xref="GeneID:5651101"
     CDS             complement(18120..19013)
                     /locus_tag="LMJF_19_0100"
                     /codon_start=1
                     /product="putative fibrillarin"
                     /protein_id="XP_001682587.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651101"
                     /db_xref="GOA:Q4QDL1"
                     /db_xref="InterPro:IPR000692"
                     /db_xref="InterPro:IPR020813"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QDL1"
                     /translation="MRGGRGGFGGRGGGGRGGGGRGGGGRGGGRGGGRGGGRGGGGRG
                     GGGRGGRGGAGAPKGNIFHPHARFNGCYLLAGKDTLSTRSLVPGVSVYSEKRVNGTVA
                     GESESNEFRVWNPYRSKLASAIYAGVASIYMEPGSAVLYLGAASGTTVSHVSDLVGPE
                     GVVYAVEFSHRSGRDLEEMTKRRSNIVPILEDARYPQKYRMLIPRLVDCIFMDVAQPD
                     QARILALNAQHFLKANGGFVISIKANCIDSTADPAAVFASEVQKLKDSGLRPKEQVSL
                     EPFERDHCVVTGYYKNVPQAT"
     gene            complement(<20416..>20901)
                     /locus_tag="LMJF_19_0110"
                     /db_xref="GeneID:5651102"
     mRNA            complement(<20416..>20901)
                     /locus_tag="LMJF_19_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682536.1"
                     /db_xref="GeneID:5651102"
     CDS             complement(20416..20901)
                     /locus_tag="LMJF_19_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682588.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651102"
                     /db_xref="GOA:Q4QDL0"
                     /db_xref="InterPro:IPR000996"
                     /db_xref="UniProtKB/TrEMBL:Q4QDL0"
                     /translation="MNPGSPAEPHPTPVAMSPPPSSDGFIASSSRAGSPNCPPTPLEK
                     PSAANVAKVDALMKQIASRTAAMDAATKEKEMKIVTAAQEYLKALMAKRGEEVMNAKA
                     IHKEEQQVGAEKINEHKKSGDVWSAVGLLVDLQKPNQYSRSTEQMRTVLSALNATPAK
                     K"
     gene            complement(<22331..>23020)
                     /locus_tag="LMJF_19_0120"
                     /db_xref="GeneID:5651103"
     mRNA            complement(<22331..>23020)
                     /locus_tag="LMJF_19_0120"
                     /product="putative QA-SNARE protein"
                     /transcript_id="XM_001682537.1"
                     /db_xref="GeneID:5651103"
     CDS             complement(22331..23020)
                     /locus_tag="LMJF_19_0120"
                     /codon_start=1
                     /product="putative QA-SNARE protein"
                     /protein_id="XP_001682589.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651103"
                     /db_xref="GOA:Q4QDK9"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:Q4QDK9"
                     /translation="MPLENGEVLSRCIQQVAKACSDAQSSMKELGTGRDAIARGRLRR
                     TRLLVQQCNSRVEEVLSDAEPSLESLRQQYAQQKAVFELINVEATRRERQTFQQKDPA
                     SMREGDLDALESQVTFCEARPLNMSEFHTEEAIQREKLQSAREIESDVMDLKMAYQEF
                     HSLAHQQQESLDRVTNNVTESRSLIERGHDQIQGATRRQRSFRKIGCISGAVVIVIMV
                     IVMIVVMVLTR"
     gene            complement(<24025..>24786)
                     /locus_tag="LMJF_19_0130"
                     /db_xref="GeneID:5651104"
     mRNA            complement(<24025..>24786)
                     /locus_tag="LMJF_19_0130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682538.1"
                     /db_xref="GeneID:5651104"
     CDS             complement(24025..24786)
                     /locus_tag="LMJF_19_0130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682590.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651104"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="UniProtKB/TrEMBL:Q4QDK8"
                     /translation="MSQNFGDWFNQLGLVTRASLVASVGLSAACSLNVMGVGSVILTS
                     EAITSLQVWRFVTAALYLGNFSFPWLMTVAMFVTYVKNNEESDFKGKTADMAYMFLLL
                     LGVLSSAGLFFNVYVTSFSFLMALCWIFCKRHPEQELTLFGFSFRSAVFPWVLMALHL
                     VMGQGLLADILGIVAGHAYVFFKDVLPVSHNQRWLETPMWLRHQFPQPTHRVASFGPE
                     VHPYDPRFQAAWRGEAQQRSSGSHNWGRGQTLGSS"
     gene            complement(<25943..>27838)
                     /locus_tag="LMJF_19_0140"
                     /db_xref="GeneID:5651105"
     mRNA            complement(<25943..>27838)
                     /locus_tag="LMJF_19_0140"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682539.1"
                     /db_xref="GeneID:5651105"
     CDS             complement(25943..27838)
                     /locus_tag="LMJF_19_0140"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682591.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651105"
                     /db_xref="GOA:Q4QDK7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q4QDK7"
                     /translation="MQPSSDNGASTGANVVVEGKYTIQDANIVGRGAYSVVKVCTPIH
                     PYVPPGSRPGMKYVVKIIEKDYLISLAKGDVDMAMAEIKREIDVLRHIPSHENVVTFL
                     EYVETEKQFLLFFEKVQCGDLCELILQSSSGKLTEEKSKLYTYQVIKAVLHCHLHDII
                     HRDIKPENLLVSEDDNIKLTDFGLAKRSRGVCTGDSPRDPLDVTALMMPYPGCERLLG
                     KRVVCSDVIGTPRYGAPEMFYAKFTQTHYDGFNADTWSIGVVTYITLSGSFPYSPGSN
                     ASEKEVFRTIMSTPLPKPSGISPLAWEFVQSMLNKDPSKRTPLYAALNHPWLSDVVVQ
                     RGSVVAAQLRASAISADVESAAARFDEEARCLRICMATLQSEVAALREERDRVREVQQ
                     PALQETHTPARRAQTPSGLSRPRSTRYPASTIRVSSPARVINHRRTGSHDSSSAGSVP
                     RRASAPRGRSPLARSAGGAAVRRGTPARAGGTTPARSATPSRTTGARSGSAARAMIST
                     RGATPTRSATPGRSAHDRSRTPHRSAISGTANGTTSGVSHSTNAVNPANELHLGDQVT
                     YKGCRAIVRFNGSTAFGAGIWIGLEMLEGNEGTNDGSSFIDKKQYFTCPKGKGVFVRA
                     SQVKKLG"
     gene            complement(<30207..>31049)
                     /locus_tag="LMJF_19_0150"
                     /db_xref="GeneID:5651114"
     mRNA            complement(<30207..>31049)
                     /locus_tag="LMJF_19_0150"
                     /product="putative mitogen-activated protein kinase"
                     /transcript_id="XM_001682540.1"
                     /db_xref="GeneID:5651114"
     CDS             complement(30207..31049)
                     /locus_tag="LMJF_19_0150"
                     /codon_start=1
                     /product="putative mitogen-activated protein kinase"
                     /protein_id="XP_001682592.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651114"
                     /db_xref="GOA:Q4QDK6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QDK6"
                     /translation="MAAISTKELMEVTLGKKLGAGSFGSVFVGVLPSGNFVAVKILEL
                     SDDAPSNTEVEIHRKMVHPNIIRYLYSRIDLESTPKKLYVYLEFVTGGSVTSLMKSLP
                     NGCLPYAVVRVYARHMFQGLEYLHSNQVAHRDIKGDNVLISMDTGTAKLADFDQAKIM
                     NTHSTLRKAATATLAGTPYWMAPEVITDEDGYDPFKADIWSAGCTVAEMITGRAPWTP
                     MPNVMHIMNKLALSTGWPDAVPKDAKELGSQDAYDFLDLCFQRDVSKRPPAATLLKHV
                     FLRV"
     gene            complement(<33351..>34493)
                     /locus_tag="LMJF_19_0160"
                     /db_xref="GeneID:5651115"
     mRNA            complement(<33351..>34493)
                     /locus_tag="LMJF_19_0160"
                     /product="putative aminopeptidase"
                     /transcript_id="XM_001682541.1"
                     /db_xref="GeneID:5651115"
     CDS             complement(33351..34493)
                     /locus_tag="LMJF_19_0160"
                     /codon_start=1
                     /product="putative aminopeptidase"
                     /protein_id="XP_001682593.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651115"
                     /db_xref="GOA:Q4QDK5"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q4QDK5"
                     /translation="MSKNADQEEWEDYGDEEVQDEEEEDTTINNSDVVVRYKKAATWC
                     NETLRVLIDATKPGAKVCDLCRLGDDTITAKVKTMFKGTEKGIAFPTCISVNNCVCHN
                     SPGVSDETTQQEIAMGDVVHYDLGIHVDGYCAVVAHTIQVTEDNELGKDEKAARVITA
                     AYNILNTALRQMRPGTTIYQVTDVVEKAAEHYKVTPVDGVLSHMMKRYIIDGYRCIPQ
                     RRVAEHMVHDYDLEKAQVWTLDIVMTSGKGKLKERDARPCVFKVALDSNYSVKMESAK
                     EVQKEIDSKYATFPFAIRNLEAKKARLGLNEMAKHGAVIPYPILFEKEGEVVAHFKIT
                     VLISNKKIEPITGLKPQKAPALEPYTDEMLLATNKLSLSLEKKAAK"
     gene            complement(<36013..>40488)
                     /locus_tag="LMJF_19_0170"
                     /db_xref="GeneID:5651116"
     mRNA            complement(<36013..>40488)
                     /locus_tag="LMJF_19_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682542.1"
                     /db_xref="GeneID:5651116"
     CDS             complement(36013..40488)
                     /locus_tag="LMJF_19_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682594.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651116"
                     /db_xref="UniProtKB/TrEMBL:Q4QDK4"
                     /translation="MARRALAALLLLLCCLLARSEAALTTVFGGCEAGTSGYVIHSSS
                     ENDKGVQHLIDNGIAFAILPATVTNGVVTWESGEVATWMPPGFQAPSDAHYRLILRKN
                     GAWAAVSMPFTWSHLCTDGREDAETTTTTTPIPNTTMTSTTTTTPAPTANPHLSSSSF
                     QSEGSASSSFASPITTTTPAPYPTTSTTAAPPPSLPTVSSVMQTVRSVVFAAVPTVDV
                     MDFTSNVVYLPATATLVESMQALQAASTVIAVRFGATGPVSALFTDATAASVSFHVPH
                     ELYNVSVVTSHALSLVTLNTADVLVVGSQLRITPVLIALQQMSIGVVLSDESILEGTD
                     ILATVRFAGAGTALLYTTDVSKVITSTLSFSMVNNGAVGSRCKPSPSSIPYFITRYDA
                     RFLVPSNYVARVHAGRKSVCATYNGKSVVVAPLVIQGIAAMTTAASFPAAVAIPIRLQ
                     GGTTTGIARGAYAAFASASPDCTSERAKISLLPVSFFTGSSDSSAVPGAVLVASSEVP
                     TGSYVCMRRTSTSTKFAVRYHGKPVTVAAASMPPAAAATAPVLTIFNGSCGSLNLLEF
                     VRPPASTDDIAAYLSAVSTVSEAYRVFRFVAVEAGATAAGKAGACRRFKQEATRDAAN
                     GAMQFAFPLYLQQTNGVLCADDEYVRIDYTVVQPTNWLMSMAGVSDFASRMLVLSSGP
                     EYDAVPLSVRSSRLASVGSGTAVRISQDGSCAFGYTARIQSYDTQQYIAIPTASVGVY
                     TLCAGLYNETGTSMFVSTGSQVELASYVRGRRKWMHEAGIERTEWTPCGSASTCGLHT
                     QQAYVEVCNGAVRRNVWPQRLDGAFVGSDSVTVLMAGNLYKTRAIVLMNGVYVPVAAA
                     FVHCQQFSLLQLSTDDGATYGPAAVVLGNHPQIALSPVTDVSGVVVGFVPWNAMCGGV
                     HTGADVMVARTAAGVSVIDMSGLLFAKTEGYYAVCVRNGVAWARVTDTYIKVVNGGVT
                     VYQAEAITTGDALANQKSIHLYQTQTATWGVVGTFSPSVSLLLKLVWMDSTCTIDAAY
                     TAALRYISPSSANVTVEASLIAAAPAGVASPTLYPCYAANTFGNTAAPMPFEEHRGRS
                     ITVTQLTLSSLFYLPYLELSVSAPVDTRILLTDPQDPPITRVSLQVTSSRSDVPQCGA
                     AAMYATVLIIETDDLGRRWMTVPAWVPQTLGGSGATNVYLKMCATASSSANPEFVAVD
                     AYLVLSANATNLAGNPMSLRLTFLPLNSSTDLLDYKAAQYALVRYAATELKVPETVAL
                     VASLGNNAFEVFIDDALQTGAAPQSTLTPTQQLYQTLAKGTNLPLFLNGRDNATAWFV
                     LAKAEAVHLVDQTTVDDYPALALPVSGSAGKSFNYTGLSIALFCVVVAPTTIGFVAFS
                     VQQTIPTLSHSRFGKETAVCVETGDSPPPRNPCSLVDLEVEGGAKKNKDRDVPLVVPR
                     AEDTTQSPLYDSDDEGATHEMKDMGTSPPLRNDTFVMAHRKGVSSRSSVEDAAKS"
     gene            complement(<45260..>46483)
                     /locus_tag="LMJF_19_0180"
                     /db_xref="GeneID:5651117"
     mRNA            complement(<45260..>46483)
                     /locus_tag="LMJF_19_0180"
                     /product="putative mitogen activated protein kinase"
                     /transcript_id="XM_001682543.1"
                     /db_xref="GeneID:5651117"
     CDS             complement(45260..46483)
                     /locus_tag="LMJF_19_0180"
                     /codon_start=1
                     /product="putative mitogen activated protein kinase"
                     /protein_id="XP_001682595.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651117"
                     /db_xref="GOA:Q4QDK3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QDK3"
                     /translation="MERYTVMGQLGDGSFGTVSKAQNTSTGEIVAVKKMKQRFHSWEE
                     CLQLREIQSLRKVQHPNLVKLKEVVREKTELFMIFEYCEKNIFQIQRQRADEMSGTVA
                     FSDKEIRSIMCQTLLGVQAIHKAGFMHRDLKPENLLISGDLVKVADFGLAKEIRSRPP
                     FTEYVSTRWYRAPELVLHSTHYNSPVDIWACAVIFAELYLCRPLFPGTSESDQLFKIC
                     SVLGSPAPNEWDEGYQLARRMNMRFPTVAPTPLRHILTTAPPAAVDLMAQMLRFNPAE
                     RPTATQCLQHPYFTGSGGSSALYAGIATGQPHNPFQMAASSAVAAQSMSNVGLTSNSS
                     PPPTTSNASLFKYANLFNQGNRSPLSVSSTSAPFSGSSALQGSVTSSNIVRSVTTQRK
                     TSVPNAADSDDEFNF"
     gene            complement(<48084..>48575)
                     /locus_tag="LMJF_19_0190"
                     /db_xref="GeneID:5651118"
     mRNA            complement(<48084..>48575)
                     /locus_tag="LMJF_19_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682544.1"
                     /db_xref="GeneID:5651118"
     CDS             complement(48084..48575)
                     /locus_tag="LMJF_19_0190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682596.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651118"
                     /db_xref="GOA:Q4QDK2"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR013729"
                     /db_xref="UniProtKB/TrEMBL:Q4QDK2"
                     /translation="MPRGAIPTGQDWEEQRFNFQQRGSGGSAQPRKVTERDANRAMQS
                     GQNVQVQRKEHQRFNQQTVSAGANAKKLDEDNETLKVKKVDPHLRVRIMKERQALNWS
                     QQDLAQRISERVSVVAEYESGKAVQEERVIVKMEKALGVHLRGAKAGEPMGKTRPAPK
                     AQE"
     gene            complement(<51499..>52452)
                     /gene="ANC1"
                     /locus_tag="LMJF_19_0200"
                     /db_xref="GeneID:5651119"
     mRNA            complement(<51499..>52452)
                     /gene="ANC1"
                     /locus_tag="LMJF_19_0200"
                     /product="putative ADP/ATP translocase 1"
                     /transcript_id="XM_001682545.1"
                     /db_xref="GeneID:5651119"
     CDS             complement(51499..52452)
                     /gene="ANC1"
                     /locus_tag="LMJF_19_0200"
                     /codon_start=1
                     /product="putative ADP/ATP translocase 1"
                     /protein_id="XP_001682597.1"
                     /db_xref="GeneID:5651119"
                     /db_xref="GOA:Q4QDK0"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QDK0"
                     /translation="MSANNNSAAAPKKARQDMPKLGFWEEFMISGVAAGAAKTAAAPI
                     ERVKLLVQNQGEMIKQGTLDRPYSGVMNCLTRTVKTEGLYALWRGNLSNVIRYFPTQA
                     LNFAFKDQFKRMFNYKKDRDGYMKWFMGNMASGGLAGAVSLCFVYSLDYVRTRLANDT
                     KSAKKGGERQYSGMVDCYIKTFKTDGLVGLYRGFCVSCVGIVAYRGFYFGLYDTLQPM
                     LPVNNFIVNFMLGWVVTIVSGLISYPLDTVRRRMMMTSGTGKNYRNSLECFMQCVKNE
                     GAASLFRGAGANILRGVAGALVLSGVDAIKPYYISARAAKN"
     gene            complement(<56935..>57888)
                     /gene="ANC2"
                     /locus_tag="LMJF_19_0210"
                     /db_xref="GeneID:5651120"
     mRNA            complement(<56935..>57888)
                     /gene="ANC2"
                     /locus_tag="LMJF_19_0210"
                     /product="putative ADP/ATP translocase 1"
                     /transcript_id="XM_001682546.1"
                     /db_xref="GeneID:5651120"
     CDS             complement(56935..57888)
                     /gene="ANC2"
                     /locus_tag="LMJF_19_0210"
                     /codon_start=1
                     /product="putative ADP/ATP translocase 1"
                     /protein_id="XP_001682598.1"
                     /db_xref="GeneID:5651120"
                     /db_xref="GOA:Q4QDK0"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QDK0"
                     /translation="MSANNNSAAAPKKARQDMPKLGFWEEFMISGVAAGAAKTAAAPI
                     ERVKLLVQNQGEMIKQGTLDRPYSGVMNCLTRTVKTEGLYALWRGNLSNVIRYFPTQA
                     LNFAFKDQFKRMFNYKKDRDGYMKWFMGNMASGGLAGAVSLCFVYSLDYVRTRLANDT
                     KSAKKGGERQYSGMVDCYIKTFKTDGLVGLYRGFCVSCVGIVAYRGFYFGLYDTLQPM
                     LPVNNFIVNFMLGWVVTIVSGLISYPLDTVRRRMMMTSGTGKNYRNSLECFMQCVKNE
                     GAASLFRGAGANILRGVAGALVLSGVDAIKPYYISARAAKN"
     gene            complement(<59317..>61545)
                     /locus_tag="LMJF_19_0220"
                     /db_xref="GeneID:5651121"
     mRNA            complement(<59317..>61545)
                     /locus_tag="LMJF_19_0220"
                     /product="putative polyprenyl synthase"
                     /transcript_id="XM_001682547.1"
                     /db_xref="GeneID:5651121"
     CDS             complement(59317..61545)
                     /locus_tag="LMJF_19_0220"
                     /codon_start=1
                     /product="putative polyprenyl synthase"
                     /protein_id="XP_001682599.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651121"
                     /db_xref="GOA:Q4QDJ9"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR010791"
                     /db_xref="InterPro:IPR017446"
                     /db_xref="InterPro:IPR023374"
                     /db_xref="UniProtKB/TrEMBL:Q4QDJ9"
                     /translation="MSEDWPQHFPPRGTVPDAEVYDQFISASTLQWWYVNAHLTVKGE
                     DNSSLAFFASFFRQAGDNCPTAATKYYDACVWALIDLKNKKCYAESALDPESIDQLKL
                     RLDPAVMGRKLEHVEVALLELLNKGRVPRPDRLLKRKAVYTQHPFSIALDDSCVMTIA
                     QEGSARRYTFSLTNAADDVHVEVCLETQQQPVLHGKDGCVNGMYYYYFPSMSVTGYVV
                     VKGLKREVTGLGWYDREVGGSTAEVDREAKYTWSWLSLHASNMSQLSIFYISGNAEDE
                     GKERVIVETRADGSRHYHDDLIMETNKSWSSLVTFMQYPSEFRLCSASMGLDVTIHTA
                     FDAQEIGTVLVGGAGFYEGVVEGSGVCSGDAVTLRGFFEYKKNAAPYRNTSELLKYVG
                     SYVHGALEEIYPLAASDSWLSENVLGRYAMDRGAPADKICETLFRPVRSIIDRGGKSW
                     RSLILVSCCNALSRQYFDCRRYIAVAELLHVGSLIIDDIQDNSVVRRGGKCVHVEYGV
                     ATAINAGSACYFMGPRAARIQDLPPEKASRIYQLYFDVLLAGHAGQGLDIYRLDYLMP
                     KVVETGDASTLFDALDAIHTYKTGGAVGALCSMACVLCEAPTVLSEAVERFGLALGLA
                     FQIVDDALNIRGFEENLKEEAEDIKDGKITYPTAIAMGRLEAADRQTLWAILRKPTKE
                     AADIQQAVELIMKVDATSECFLIARHRLQEMWNALDPLLEDSFPKLLMRTFCSFLVER
                     KY"
     gene            <69069..>71030
                     /locus_tag="LMJF_19_0230"
                     /db_xref="GeneID:5651122"
     mRNA            <69069..>71030
                     /locus_tag="LMJF_19_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682548.1"
                     /db_xref="GeneID:5651122"
     CDS             69069..71030
                     /locus_tag="LMJF_19_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682600.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651122"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:Q4QDJ8"
                     /translation="MDNAPGLYAEKPSSTYCEEKYPNKVEEVGSLKPPTYDVPHGRSD
                     NIKTPEFNTSLGKFDQAPYFTGGPPAMRYHGYKRDPAVEGVDYRDVLPKTPIEDHHPH
                     MEFLSVTGRREGSTFLLANAGVNWELKAAAMSLYRTILKSLPMIKHYYWLLVPLPAMK
                     DKIRLRFLQNQHTKDPDAIRHLLHNGWMEFQESIMFRRPRATIEKYFEHESMDELSKQ
                     YTKEEGLMNSEREFWNGEEQRREGPHNGHWSWLGEQCEKEFTKIAGRIPISWTASKGY
                     FEKGQADGTNYWEKNLDYEGWYIKNVDPDRQNARREMQGWVESGYNQPKHYASKNRRG
                     YRRMVKDIETLMETSMEDLYTHNREQLFQYLIRESSPESNRINAERTLAYQDDDFYST
                     RFEEYEKYLKQAMREMPNPRLWKTDAFYFRLRYLLAPLEYNWAKVPVGATQEKLFNEW
                     ISDNCNYAIYTSSVFTQIKADKTRNPMAKTWADFYTEFDPDVPETRNLPWYHRDFDYD
                     RRHKWDERCMRMKRWVQSGTIDGKHAYFDSIVAEWEQYVNRPERFRAPDSAERRYAAP
                     RMVQLYRALNRVMDVALADQMRQTIEKGCDLSKMSVEDVQRRLAAADFTNFRFEVPVI
                     IYPDCAAQPQLGLNGCAVATAAASATAAA"
     gene            <72728..>74743
                     /locus_tag="LMJF_19_0240"
                     /db_xref="GeneID:5651123"
     mRNA            <72728..>74743
                     /locus_tag="LMJF_19_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682549.1"
                     /db_xref="GeneID:5651123"
     CDS             72728..74743
                     /locus_tag="LMJF_19_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682601.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651123"
                     /db_xref="InterPro:IPR014813"
                     /db_xref="UniProtKB/TrEMBL:Q4QDJ7"
                     /translation="MVKVKASKSKRMSSKQRHKIDRKKREHKRDLKKAAKALKKTGMA
                     PKRSKKSRDMAKLALQVSNRHPDKEQILSHVLQARETARVMKAERRARKGTDAETDGG
                     EENQTVSVGACASNRRQLLYISAKDSNHFRVQFNRALTELIFPAAATAEVSADVPTLE
                     LPAAAYVVTLDVRFAVQSMPWTLLDAIIDQAAGYTGGRKVLLLFTLTKADVVSAPAMV
                     SQLALVAFALQQRYPKGLGANIVATVTPFSVHSERTQRQFLRVLNQFRQNEGCSSKKM
                     ASNLTGKICAFVIGLPNTGRRTLCRTLSREANESGVSTVPLRAAQLQLIRSGLTEEEE
                     KVHTKFAMPNAKAVTLVQLPEDAGMMKELHTPVGGDVLFRSLAFVERAPEPEAMGCVL
                     FDGVADKTTMAQAFCVPAVGGAEGEEKKPLKVAEKFLRELGRAVRRDGGFHVSPLFAS
                     DAGTMGKVTSSGLTGHGGFNSGQQHSQSTLLNVTYSNATPSKLVHISTVMKKGKGKAR
                     RYQKVSRSDAHNALRLGARTFLREMSEGRHVPWAVMRAPGDVTLTPAEVGAASEIFSV
                     AAAEGKRLAGTDELKGTDHLNALVDVLATAVRDIAVILPNGVVEMNPDFLIPPQYKLE
                     KDEATVEETDEDDVEEAAGAQGGSDAEESCEEAAEGSEEIDLEDEES"
     gene            <76489..>79116
                     /locus_tag="LMJF_19_0250"
                     /db_xref="GeneID:5651124"
     mRNA            <76489..>79116
                     /locus_tag="LMJF_19_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682550.1"
                     /db_xref="GeneID:5651124"
     CDS             76489..79116
                     /locus_tag="LMJF_19_0250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682602.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651124"
                     /db_xref="InterPro:IPR001943"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QDJ6"
                     /translation="MFHSEAKYGPRLHMYLCHVSSHDEVHPADALRAQDGYSCGWVSR
                     KHASYPQEMGFRFDGIVLANTLRILANENKISSCMVVYVAEPTAQEEQHGVCGPYSKA
                     AFKRLGHVSFSNNAASDYQARELKTVGLQRCCTYLKLVLRNPHPNGYNIFQQIGVVAL
                     AVHGNLLKKLRDWIDTPLAIHVGERATVPLDEMMPTPHSEYAPGTPARVTGKLITRVS
                     ELAALKQRAVEEEDFDAAEALKQQIITIENGEREVAQLELEKQRAVALENYKLAKELK
                     LRIETLRVANEKIAAAPPNTAPSATAATDAFSSPPQHRSPTVGASGSAVAQEKGNSTA
                     SSRPVQRGWNVHDEVLVGGKGYYDLSDATGGLTSKQPSKQNGADEDEVPLSGDGAAWE
                     VVLNTAIKRVLTAPVGPSPLTGDAAAAAKPYTKDLGVYCVACLFSRKGQQREAALRGA
                     VSSDGCQALASHSTAAWTQLVLYMSVKGYGVGDQVAGAAIAACNALTKIVQGKLPGAS
                     ANQVAESVTKVLPELTARLGESNARVQESVEKTIVAVARSPLGHRRIVELLLVDPDKQ
                     NKKPASVRAHVSRINVLSTFVDEFGLARNAPDGLDTHSLCSMVLLPSLQHFNADVRLA
                     AVDLLAKLLFLDPSSTSGYLEDIKPVQQALIEEQLEQYKQSQLVDHSIERNVSDMQAD
                     TVAVQPRGRGSPGSPQAQPQRSSAPRAREAGAAAAEEANLHVPTAPLLQRAPALISEI
                     EYRRLRTCQFCGEYNSSFNEHNLDLHYVSACPMLCPCPLCDQVTEICQLQQHLVTECE
                     KRRLVRECPRCHEAVRATEYNEHLAAKKCIEAVLTHSVCPLCHERFKNSMDEWRHHLA
                     SSPGCPNNPRCYDGSGLAM"
     gene            <81590..>84109
                     /locus_tag="LMJF_19_0260"
                     /db_xref="GeneID:5651125"
     mRNA            <81590..>84109
                     /locus_tag="LMJF_19_0260"
                     /product="putative C-terminal motor kinesin"
                     /transcript_id="XM_001682551.1"
                     /db_xref="GeneID:5651125"
     CDS             81590..84109
                     /locus_tag="LMJF_19_0260"
                     /codon_start=1
                     /product="putative C-terminal motor kinesin"
                     /protein_id="XP_001682603.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651125"
                     /db_xref="GOA:Q4QDJ5"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QDJ5"
                     /translation="MSLPPSRGGPQAVGTSAIEAEVQELLSRELSSRNADGDPDATAL
                     LVEHIRRGNGGAVLEGIRQNFKYNPPATQICMLTVMDQCLMHSGPQFAVMLSSEKWTD
                     RLFKVAKTTTANEVREKIIYTVIKWYQRYHTSGHQRLMQRFQQSRVLGEPFQHIFRMA
                     KDQQQPRSVKDQRDFTTLSTANRNEILDTEETILLECQGDLASLEYALEHPHILPDTE
                     IANECKEHKLVCMRMLESGQHERIATELMSLIERFSEALSLFEAMTGIDVGEGDAAKR
                     RAVADKDLEETDSDDDDEQRRLRQRRRGGKRADATAVMMQAQQETENLVNRERSEALQ
                     LRAQLEELRQKHEELQNKYKDAKAKNKEAVGMLEQYAQRVEMLETGANGADSHLSPLP
                     VLGATSLGALDSAAGKGSVSPALTANMRSFLAAIRKSLREIKEVYCTDLSQQGRYYSA
                     QISNAMAAMIQASDMDREADRKALQWTQELYKREVKLRKQYYNTIQELKGNIRVYCRV
                     RPMLSKEIKGGYSDVMSYPTQDEVRLIDASGRPKLFEFDEVYPPTAPQARVFEDTAPL
                     IDSVVDGFNVCIFAYGQTGSGKTFTMNGTEGENKGINTRALERLFGVIEERKETEVST
                     VTVSVLEIYCEQIRDLLATKKEASGLTYEVKQGGPYGTYVTNLKEVPVTSAGDIDGIM
                     ATAQTHRSEGMTNMNEHSSRSHMLLYIIVRTTNKQTNMQGYGKLSLIDLAGSERVDKS
                     GAEGQRLKEAVAINKSLSALGDVIAGLAQNSKHVPFRNSALTFLLQDSMAGQAKVLMF
                     VCVSPASYNVSESSSSLLFASRARGVAFGQIKKNATTEKAS"
     gene            <91746..>94631
                     /locus_tag="LMJF_19_0270"
                     /db_xref="GeneID:5651126"
     mRNA            <91746..>94631
                     /locus_tag="LMJF_19_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682552.1"
                     /db_xref="GeneID:5651126"
     CDS             91746..94631
                     /locus_tag="LMJF_19_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682604.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651126"
                     /db_xref="UniProtKB/TrEMBL:Q4QDJ4"
                     /translation="METNRPPSTAKWVSRRTLDSQANNRENNAGLTHPRGSNSDKNPN
                     NANYHHSAEKRKYGHAPDAVIAAIGRGSGSGNGGGAAAADNSPSAPFHTNGGCGSNRF
                     GISGSGHGGGWGSNAPNSHATNNNELNHQGNTFGTNTVNAHGPHSNGNNNANGGSRRG
                     YGAGGGYGEATEPTIPPPPRSVQMGQGTLSAQAAAATSRDFIPQPRHAKANSSASSHS
                     LKSMEASPPPPGAVPSVPPATHSPSSAPALRWGFNAARTPRSANGGAATPNAPPLGYT
                     AASHFDALAGLLVSKSATPSPLASAADCGGPEATVAAQTPPPFTAAPLAFTTTVPSVN
                     ACLTSTAPGAGAPAPQRPSATTSAMNVEPSPLDSFHIGENLSFGASAFGGSLHSHPSE
                     IETLLGQVERSAGTLPVGAAGERVIGGSLRERRSVTDWGIEEAIRTVLPGMDEDENSD
                     NIQGPNFSGGIAAITGNWHTSGDVEAQPVASGGVIGLLADFPTSFAASFSESASTLLQ
                     SPFAVDATSNTIDNLSRAFSTAARVDCCSFTTSPATTTATPLQRPPTSPGVRLPNHVT
                     PVEAMSMPPSMRDLAHHSGSLYTAPTATPPPPPRSTKSEASARVEDLPGAGQGGSSEL
                     FNLYTLPPPTTTSPWLSSGIGEAATPMAPVNRTSDSMTAKLPGHRSPRTTTARPERLQ
                     AIPLKEGSMNSNGGLTTTTGSTTSPALAAARQSSTSSHGGSAPNTPSLRKELSTPLSG
                     SRSQPYTPGGLRPQRPSLSAPLVNRHTITHIFRETPQSLRRRERMEHNHYHSDRALCK
                     DLHWPPHDEADAEHMLRERNATKLLRHLTIISFSRQHVSGVQELFDTWAKNGIPAPDM
                     GFGAYYFYVKEKSEKLLCMKHNGRGASPGHGYGRCDFESRRPYSTCRYEHVCLFCRSK
                     EHGWFEEGKCQGYQQLLTEMEELGVTEEDVVTLLNAMERPVKPTRSR"
     gene            <98128..>100029
                     /locus_tag="LMJF_19_0280"
                     /db_xref="GeneID:5651127"
     mRNA            <98128..>100029
                     /locus_tag="LMJF_19_0280"
                     /product="putative sarcoplasmic reticulum glycoprotein"
                     /transcript_id="XM_001682553.1"
                     /db_xref="GeneID:5651127"
     CDS             98128..100029
                     /locus_tag="LMJF_19_0280"
                     /codon_start=1
                     /product="putative sarcoplasmic reticulum glycoprotein"
                     /protein_id="XP_001682605.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651127"
                     /db_xref="GOA:Q4QDJ3"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QDJ3"
                     /translation="MSISGAAAPAPLRGRESGGNVPGSMGALIKKLHPLYTQRVRPLE
                     EMYSFDVFRPSWYEETILNERPFITLFGPWSAGKTTFINYLLQSNDLWTGPQPTTAEF
                     TVVMYGKEPGPVAGQALANSKHLPFKGLLDFGESFIRNLKGFQAPHALLERVTLIDTP
                     GVLESAKDIHQRKYDYVNVCRWFAERSDLIFVFFDPSKLDAGGELRQLFQTSFKGFEN
                     RLRLVLNKADTISTQELMRVYGSLFWNLSNFINTTEPPRVYVGSFWDKPYSPNSFSRL
                     FAEEKLDLLHELLEVIPQQARDKKVASLIRRAKEVLVHAVILGGIRADLPLLFGKSKA
                     KKKAAEQLPRRYELIGARYKMNHRDFPPVQAYRSFLERFDVAKFPPLQKAEKAGLIRG
                     IQELIDTILPSMLRPVCNTRAANPFEEDKQTGLLSMYRDHVLLQRDGRPGMQGGTDKV
                     ASTMGQGVPDSATTGPSSSVAAAPASGPSSLLGPGPAVTALSASPPFIELPSRAMAAS
                     STAVAASSPPPPPPSSAAATSSPADMQAMMAIMQQMVAYQQQQQQQQDRQSSSAPATV
                     NSHGTLSSSSSETSGCLAESSVPVTPQESNLNSEPQPPTVVPQLGLPNSCATQISAWA
                     GGDESKSQH"
     gene            <101922..>106034
                     /locus_tag="LMJF_19_0290"
                     /db_xref="GeneID:5651128"
     mRNA            <101922..>106034
                     /locus_tag="LMJF_19_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682554.1"
                     /db_xref="GeneID:5651128"
     CDS             101922..106034
                     /locus_tag="LMJF_19_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682606.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651128"
                     /db_xref="UniProtKB/TrEMBL:Q4QDJ2"
                     /translation="MCSPHWGHLCAVGFRVRMSLQGGRRVVLQKPHLLLARARQLQEC
                     TMQDSLKIPSNSTEPHSASSAKTLKDSRCTETRQRRPAGLFETWGWSPHLQQTLGATL
                     CSAPLESVAAFRAAVEANMLAGSLCKGAQLIPVVGARGSRAMMPAPFVAGQRTAPARD
                     GAREGWAAARCPWNTRCRVLQPPSSLRLGCSSTSAVASWVTAWTSEPMGSPPKLLHPW
                     PAWTEAHTDRPTLRLFGLPASVRAAFLDVPFPSPSTSSSLPTPAALMEAACGAALAQL
                     AGQVQDAVEHGQLAATSRLYFCPLAHAVDYSGTLDLRAFAVEWGRRHCDGGSGGGASA
                     APRTTAVLSDSSPVLSLGAELPISDDADPADAAAGRAASTPPLRVVVFSNAHMLSKRA
                     IRRLLDQWTRNGASVRKLRQQQERAQAGPREWRTLMGSRLLLPLDAAAILPHVRSLSI
                     PFGDVQAVFIGYTASQGPVEGAKVMNSPLDAGRHAPLPLPVLPPSTTPVGFPVRVELA
                     VSTSAHADLLHVEEPLSAALLRASTLYRRCLDAAQRRELVEAVVQSTVDGAPAGAVFA
                     KRQSQRLSSGRIFFETSKVPLTGTQGRLQLHEACEAALSLLSPLESLLHPHLGTERAR
                     GNRPARDDDVVSLLVMYPLLSTVHIRHVLLSAFHVRVTPTSTAGDEAPPAVAAAAAAA
                     AVDGPVAAAEMVCLRGGNDRTTAGAATPPPSDPRVRFVASRLRANEHEQRERDVLLQA
                     AKVRAAAAAAVTATPSCAPRAPLLFQAYAAHVEPAVLLGLWTPTLLFRAPTLADVMAL
                     RCFLLEPLRTSYAASHRTPTEALPRANFADGGGGGGMIALRVDDVDVIHFDYADGATR
                     HRRTHRLFGVRASLCPASAATPPPRTGAGAVGEESLRDASGRNLVARELALLETLLQQ
                     CLKECARAATFFPLWTEHRRYGDAAPCATTHQNSEAGPMTNHGDGGPAGLNLLPFPFF
                     PSSTNHRSLLDFPGVTESLASWAPRSTELRLLSLAAAQRPSLSLTIRSRVVLLESVYV
                     PASDEVDAPDDDAGKVAARSGRKVPNRVVARRGEVCEVAGFVPCSLLLGRGVASTASE
                     GAGGSRSRDESATREMSLPRLVRQQVAGWSLTERRLIEHYMAQQQHASALPLLRCCAA
                     PQPRREDHLRQPSTSLFVLPPRCTVVGGYRSLHYYGLPLLHLPLLILAGGLARAQPPH
                     SAVSPSKLSKTALGSCKASRASASDSDIGAPPALLTATSPSASFDYALPHLFHPHHAD
                     PASCRATLCLTSQERQQALDLLFAQLRDATAAVSDGVKAACGNDAAPRSLISFVEDVL
                     FTEMSDGTRNKKSADALTAGDRNSSDAHAVLTPPVCCPLLTEMALYSHVR"
     gene            <107698..>108642
                     /locus_tag="LMJF_19_0300"
                     /db_xref="GeneID:5651129"
     mRNA            <107698..>108642
                     /locus_tag="LMJF_19_0300"
                     /product="putative RNA binding protein"
                     /transcript_id="XM_001682555.1"
                     /db_xref="GeneID:5651129"
     CDS             107698..108642
                     /locus_tag="LMJF_19_0300"
                     /codon_start=1
                     /product="putative RNA binding protein"
                     /protein_id="XP_001682607.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651129"
                     /db_xref="GOA:Q4QDJ1"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QDJ1"
                     /translation="MMKSNVEADAAATGPYHCNGIMAPAMSANEPMQVVYNRTQKRVP
                     VFRDSLIMYEQQMVQVMEELRTLTMDVNALRVHYEEALQEKLYIENLAAQAEKRVQDV
                     KEIVDRYVGVKDAVVASDGFTYERETISSYIEGCKEAGGTPTSYQTEKPLTSLLIPNR
                     SLKTLVDRLVTLQKAEPTPPAPADRNPVQHHSKSITAGRAGNISINQHEGQRRNMHGG
                     GKDSSGPVELNAKGERVHPCIRVYGYCNYNESCAYAKYPYDACLSNLKNKCRFKNQCH
                     ERHVEFRGPLDDYGNCASTNQGPNQENIASEPVGEANK"
     gene            <112663..>113421
                     /locus_tag="LMJF_19_0310"
                     /db_xref="GeneID:5651130"
     mRNA            <112663..>113421
                     /locus_tag="LMJF_19_0310"
                     /transcript_id="XM_001682556.1"
                     /db_xref="GeneID:5651130"
     CDS             112663..113421
                     /locus_tag="LMJF_19_0310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_001682608.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651130"
                     /db_xref="GOA:Q4QDJ0"
                     /db_xref="InterPro:IPR001727"
                     /db_xref="UniProtKB/TrEMBL:Q4QDJ0"
                     /translation="MTIRKSTNLLDGFLSSLSMILVSEIGDKTFFIACLMSMRHPKLT
                     VYIGALGALAAMTILSALMGVVVPNLLSVQVTQMLAVVLFMAFGCKILYDELIRKKAD
                     DEESEDEMTEAAAALRRRDPNDPAETGSMASSAYVSAPARRWRKLLNPVMVEAFTLTF
                     VAEWGDRSQLATIALAAAKNPYGVTVGGILGHALCTGGAVVCGNLIAQRVSMKTVNIV
                     GGVLFIMFGLVTLYELTYGGHEIAKTHERPARTE"
     gene            <115945..>117963
                     /locus_tag="LMJF_19_0320"
                     /db_xref="GeneID:5651131"
     mRNA            <115945..>117963
                     /locus_tag="LMJF_19_0320"
                     /product="putative intraflagellar transport protein
                     component"
                     /transcript_id="XM_001682557.1"
                     /db_xref="GeneID:5651131"
     CDS             115945..117963
                     /locus_tag="LMJF_19_0320"
                     /codon_start=1
                     /product="putative intraflagellar transport protein
                     component"
                     /protein_id="XP_001682609.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651131"
                     /db_xref="GOA:Q4QDI9"
                     /db_xref="InterPro:IPR019196"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q4QDI9"
                     /translation="MTEVTSPYRGRVKEMWPAPTAGVESEAAAAAPPQTQQTKVCFNV
                     CRQEPYHPNKGYRHLARKLRQGGTVEMNKEDITLDRLSASDIVLFPAPQTPFSEEDIA
                     VIRQYVEGGGSAMILLGDGHGGQYSYLNKALDDWTGITINEDCVVRTVLHRYLHPKEV
                     CVTNGITNRAINKAAGKKVFGAVGGSPSSGFGVGAGSVGAKGVTSTMGIGSTLMTLNR
                     TVGAGQATNAALLAQSAAAGSAAAMAVDEAEQEATSLVFVYPYGLTFNVQRPAIPLLS
                     SGFMAYPLNRPIAAAWECPKVVEHLGRRKQGKLLIIGSAQLFDDAWIEKEENSTLASI
                     LFDYLDHKLKLNQIDADEPDITDYHHLPDTASLSERLRVAVEQHEELPRDFTQLFQLD
                     LFKIDTDKIPDVVDTYSKLSVKVEPLTLIPPEFQTPLPPVKPAVFEAIHRDPPPPGLD
                     LFDLDEEFAPERVRLSQLTNKCKADDVEYYILQAAEVMGVTKKLRSPRNRDPRALLDY
                     VFRQVVDYKKVNSGPVASQEAIHGDTASGAAAADNAAAAAAAENMMRVIRVSNDGTGD
                     PTPFDENPLWNLYLEADFAKGTIEGNLQLLRDSSRFGAQEARIEGDIKPPGEREYPME
                     WGVVLDAANGEQIIYVFLGMIQGNQLRGVCEQGGGGNTRNFLYTLEEL"
     gene            <120122..>121906
                     /locus_tag="LMJF_19_0330"
                     /db_xref="GeneID:5651132"
     mRNA            <120122..>121906
                     /locus_tag="LMJF_19_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682558.1"
                     /db_xref="GeneID:5651132"
     CDS             120122..121906
                     /locus_tag="LMJF_19_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682610.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651132"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QDI8"
                     /translation="MKKQIKWKAHKGVVLCADWSRMSGMIVTGGEDGVYKVWDPYGCS
                     IFVAAAGEHPITSVRFAADGESFAVGSFMNVRVCDKTGWSHSYERTTEGSAMALDWMP
                     DGTQMILGNGTGALSIAQIVDRKVSWGPYTVTLLDSRRLTVQDVVKDTVQEIELADKV
                     IKLELGCGYLVVCTTTQCCCYPMDRLNAPVQFDLRDPVISIILGPRQFLLADCSQGLQ
                     VYSYEGRQISVLRLQVTLKPEIMTTNLLSLSPETVAMRNPADAKRILFFDVSSGKPFD
                     AASVAHHLDIVSVHLSQSGSLHDRKIAFIDRNNDLYFGPVHTQLGFHKLSTMTTSVAW
                     HDSHETLVAIADGHLATWYYPSTIFTDRDLLSLTKTVRDGGHTEFTRNDRITHFHHTR
                     VLVRRGGDGALLTLPVSPYTVMIFQLVTQKNNWDGATRLARFLKDPLLWAVLTALALR
                     AGELNVAEIGYGALSDLAKVRYIHYIKGIPTPEARQAELALFQHRPAEAERILLQAGL
                     VYRCIDMNTRLFKWERALEIAKERKTHLDTVLGRRERYLQEVSQKEMLAPFKDLSGKV
                     KVDWAVIEEKVKQEVIKESERPNAKPYA"
     gene            <123313..>124689
                     /locus_tag="LMJF_19_0340"
                     /db_xref="GeneID:5651133"
     mRNA            <123313..>124689
                     /locus_tag="LMJF_19_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682559.1"
                     /db_xref="GeneID:5651133"
     CDS             123313..124689
                     /locus_tag="LMJF_19_0340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682611.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651133"
                     /db_xref="UniProtKB/TrEMBL:Q4QDI7"
                     /translation="MIGGEYKKERLSERLTMAQNQPKNRGYLPGTHLRTGGYGTGTLL
                     GNWSEERFDAGYYDGKAVVASSLRPVWSTTYREMVQNVSAPPGFVASASGADSSSCAT
                     ASRTPEATACDRTQFSQQTFMVIEDRTGRSYPGHQPQLDPAWQEAVQSSHHSTFQSSY
                     IHPDVRRQEAKAYVPPVLGGKPSSQSTGVLLRLRRQLELAQESLHGAAGTCTVVSAFP
                     GNVIRSVRKALANACTDPNGNVNTDELQEGFAAAGVTAAPAECVALLRYFDHEGHLTA
                     PYMAIVEAVRGEMNSRRADLVESVYSLLRSFSPEGVVRLDKLVEWVDVEQLPAVQSGS
                     VNADAARAAFAAQWDARTPTAHITQARFADFFADASFEIPLDNTFELTLRNIWHMSGG
                     RGNCENTSCRRVEVVHTNGRVTKEEIKNDLLVKDSGDGAALDSLLRANLAKQGIKDVK
                     SVRVVSPV"
     gene            <126934..>128166
                     /locus_tag="LMJF_19_0350"
                     /db_xref="GeneID:5651134"
     mRNA            <126934..>128166
                     /locus_tag="LMJF_19_0350"
                     /product="putative lipoic acid synthetase, mitochondrial
                     precursor"
                     /transcript_id="XM_001682560.1"
                     /db_xref="GeneID:5651134"
     CDS             126934..128166
                     /locus_tag="LMJF_19_0350"
                     /codon_start=1
                     /product="putative lipoic acid synthetase, mitochondrial
                     precursor"
                     /protein_id="XP_001682612.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651134"
                     /db_xref="GOA:Q4QDI6"
                     /db_xref="InterPro:IPR003698"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013785"
                     /translation="MCPTAVPSRVSPVAAAAAADIAGSSESTVSLVADVDKKNSQYKQ
                     IFLERFRKKLQSDKTGMNNLESFVELPEGVAPSAASIGPIKRGSEPLPPWIKLKVPKG
                     MTHRPRFNRIRRSMREKNLSTVCEEAKCPNIGECWGGSDEEGTATATIMVMGSHCTRG
                     CRFCSVLTSRRPPPLDPEEPEKVAAAVHEMGVDYIVMTMVDRDDLPDGGASHVCCCIH
                     TIKKKNPELMLEALVGDFHGDLKLVEQLAVTPLSVYAHNIECVERITPRVRDRRASYR
                     QSLQTLEHVTKWTNGNMLTKSSIMLGLGEEEAEVRQTLRDLRTAGVSAVTLGQYLQPS
                     HTRLKVSRYAHPKEFEMWEKEAMDMGFLYCASGPMVRSSYRAGEYYIKNILKQRQSAE
                     GGKAAAAATAVNAGTAIA"
     gene            <131071..>136653
                     /locus_tag="LMJF_19_0360"
                     /db_xref="GeneID:5651135"
     mRNA            <131071..>136653
                     /locus_tag="LMJF_19_0360"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682561.1"
                     /db_xref="GeneID:5651135"
     CDS             131071..136653
                     /locus_tag="LMJF_19_0360"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682613.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651135"
                     /db_xref="GOA:Q4QDI5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QDI5"
                     /translation="MSSSNLVTDAYHSTESTINVLFSSPADANPVTDKQATKVPVVPI
                     AASLFPANAAVMIDDDLAPGVADAGATAEPAVRSPLSVEREAFENSIAGIGGGGGALS
                     QSVVSRRDMSLADISRMRLEGCRARHTLFAATTSLRGSMASSLRSASLSPMFPLTGRV
                     RDHAGIFDETTSAAISAASQAPAWSSLNGPGRSFNRRSSLLSARTNALDTSIAILQHM
                     AHDTAARVEAVCNAQSLAGTASTATSACGSVALPSLQPTQLYSADTHASARGYKVVGS
                     GSTASVEDSCSDSDQHTPVLHTVHTRQFTRALDSPSPLNSLSESELRSGHLRAGGCSH
                     VSAQASAARLTGGAGVAKAASDLQHSSPRSHPDRSPLPARRQTNDTADHRAPHQSVAA
                     TDIGVALPSAENQTTDVSVYNHDFQHIVPLEVKEALQRNMRPICEDDDEDEDALLHDG
                     LRAPMPPPLTSFANVTHSMYEDTCNLDTPSNYACTHGTVSVGCAGAAIADAPFSFPSS
                     ALHAPSRLFASPNAPALQTATPSMIAWQTGGTVEAKPIRPFGSGTAETLAAGLSISGT
                     GVPFQTWKFPSLGKPNSASSLRKTSLGENGNAEALPESAVGGAAAARQPAVPLSEHCS
                     HPTRETLVPESPQRQCSESSPLTRNGRQATSEHNTLNAAATPCSSVAVGALSGAGDVG
                     PCAASLLSGVDGTHRMSSVAHGTPVRSNDGAGGHFVQAAVAQGSTPSAAGSLSAAADS
                     SNTRKLEMMYTVYERLLHARPPDNSFPEATRRSLQTQTSPSLTEEVMPPLDMSPSTPA
                     AQQAPQSGVAGACFEAMSQGDCSPSMSYSGALSRSAGYYSFGKRISLSHPNRQTLPHQ
                     FLGSASNLHATSSPPRVAMLGTPAVAGVIVTSSGNSSGTTMAFSPTARARRRTLDLSV
                     LQRIDSRPLLQSTLLSQNNMCTICEAQARFTPKERVEDAGRADQRTAISSAPSKAAVS
                     VTVESVPQYTVPLEEQSAAGLPSPASVADVETREGVAGVSQGRMTGHTAIAETASPVG
                     LGSAAASATAVSAARESQQTSGSCRDTQVPSVDSVLPSSVSSSIGKRPNASSLSLDCI
                     HEGQGGQEEHLRKQAEMHVNPTAATATGVSVAHESNGISPHRCYQALTEAKRLVRHVH
                     GVDGVEREVDDDSMNLVVHVGMHLMGWLEVVSLLGCGSFGQVFLCKDLRICDGHFVHP
                     SEIEGDDYEYWNCSHAYLPFSSVDAVPTHRPLVAVKVVKSVPLLEQQSVLEAEMLVLI
                     GAQTALPPANAAGEGCESATPTFAAATGGRIGVNEPPPADPRCANIAKVLADGICYGH
                     HCIVMERYGANLYEYIAANNHRGLPMYQIRSIGAQLFSALSLVHEECHIIHADVKPEN
                     VLLTLGSSMGTLRVKDEPSPITTTTAAAALPAGAISKSNASTTAVATKTPRSVPQRKA
                     SAEAAHRSPSSTSPNTEPPWHQQRTEYAASSPASLLLPAERSHTARVGPGAVARQRLS
                     FKGKRQNSNTLLDLSSSPMALATYKGHSFCHLRSSSASRATSVEQTDMPTPEPRRMHM
                     LSQSAGLVTSAASGMSLLSLGGGGAGSYSRQIVQAPAAPAEEAPAAPVAPAASHLHVR
                     LIDFSSSCYDGGPFYQYIQSRYYRAPEVIIGAPYNSAIDVWSTGCLLAELLLGMPLLP
                     GCNDHHQLSLVEEMIEPLPDHLVENGDNAGLFYIVAATGGEGSTDAALPRAPAAAAPG
                     ATASATLQKPRSFALRTRENYLEVTGSEPLPYRRYFTYQTLQELVRHCPLTLEERRMS
                     NGLHPYVSANESSAIPPDATPSLSVRSDMMKQRFLLFDLLRRLLQTDSKLRPTAAQAL
                     QHPFFSSLPPYFTTFALD"
     gene            <142689..>146153
                     /locus_tag="LMJF_19_0370"
                     /db_xref="GeneID:5651136"
     mRNA            <142689..>146153
                     /locus_tag="LMJF_19_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682562.1"
                     /db_xref="GeneID:5651136"
     CDS             142689..146153
                     /locus_tag="LMJF_19_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682614.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651136"
                     /db_xref="UniProtKB/TrEMBL:Q4QDI4"
                     /translation="MPASSSGAVEKRKSPFPVEAVQLTKDSVRHSGSRRGSAASWLHP
                     LSSTEVPDSDLPHNPLFSRHGVQLTNSDDIVVGGGGAGSSSLLSATEISPMRIREASG
                     RKSGLDSSSITSSSKREVRSCRGYARLTGLLTRRGGEGKSSKNVAVSSTSHSTTTCSG
                     GAPQGTVIASLSSAATRNPLQRSCNTSGEADLSEEIRLDDGGCDWPSTPSPKTASVSH
                     RCGSNSPSGAVGVVPWPSAVNSTIHSRSRRELCASPLASQSSRPSPHATLRLDGGSAT
                     NGAGLDSSGAQFVPLGSSDLANRNGSPNRLQRSYCGGVDDDKTTTSSTLRNRSLRQKL
                     ISGSSLSTSASQSLLQVGSTRASQGQTPRNTGDPDASVHLSKNARSLRDAKAALLRRT
                     QHGAAHSLRSSRTHSFRRSQSNASTGGGDPLSQRGSRMRPSSREKRSTNSTKGALAGG
                     GRVGSAHSIAAVEDDVVRISVRPAGLNSPLTHWDIDFPLTTAVPDMGSGKSEHNICVS
                     GAQRRFSRPEDNPLLEVMETSSCASQGWYEAGNGAPWCPSTAEQATRSRIAVAAGSLS
                     KSMERRTTGLSRDGSPFQKSSSTRRGTFYPPRMPSGFHSLSPNGGYSSSTDSEEEIRL
                     RERHRNRVDEVLRQLNAPMKSTTVDDGLVAASMRNNSSYPSARDASVGADASQIDNNN
                     SSAWVGIGGLDWDGGLVAFCASTTGGGNANMSTTVNANGGGGGDGGGWHGVGGAATTE
                     DWYARMRKRLEEEEKAEAVAAAVIARDANFTSAAPPSESAPTHSPATTSGNRNKDSTP
                     SEMHMPAIDRATACNRPLPLLRSTRSTRAPSAPPAHSSLPPGESQTAPPMLNQTSKPK
                     ISPGVSSTGERFVRRPQPPGIPARMQLSHTCAALGSADGGAATTHPHPPEASGAKEDS
                     AAARSPSKRLSLKSTAVTVPVNAAESADSAGAAPSPELEVMEPHHRLSAFDPDDGSVS
                     GMSGTSTVAPLMSSASRQLSEKLIAMPSTSASMVDTSHSQSDLRRHCSLPRIVPKVSM
                     TVLKPSPPGQHPHSTIATSVPSRVHNGVRLTLVPSSAAAQSSGGSSATPTREVPVSGV
                     GATTRDSVCTGADVNGGLRCNPSAPTLRQGTTARKQPTAGARSTENPTSSSGAPAVVL
                     TSARLSDS"
     gene            <150306..>156359
                     /locus_tag="LMJF_19_0380"
                     /db_xref="GeneID:5651137"
     mRNA            <150306..>156359
                     /locus_tag="LMJF_19_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682563.1"
                     /db_xref="GeneID:5651137"
     CDS             150306..156359
                     /locus_tag="LMJF_19_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682615.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651137"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QDI3"
                     /translation="MSDGSALWSVSGRCPSVQSFQSRATSHSTTKARGRTGSLSSQPA
                     AAFSSPRSSSFSHLRPLPSSKDADYLNLAHQRSFIGRFRCATPVVIRTPAAATSHERL
                     APSTIDGSTPSHMYNGKRHEETAAASVCVAAAAGATAEGGRTSPSAAPDERAQGAEAE
                     AQHAVDVPPLHAVAADHPSSLAAPGRYPRQLGRRVPDSGASMASSGAAGRGAGRGRSS
                     SVLNGARPRGLVPSSSASALVSWTGATASAGLQRRPFAARCGRLAANMEPLVKSGLHT
                     SLWLAQQDGGLEVRSMANPNQVLANLPRRDPRTVITSLTEVCGSRVVAGCTDGMLCVY
                     DAVTMKLTAEHRAHTAAVTCLLYVQGAPRLSLHTGAGTEPHANHGSAPTQSLLLTGSL
                     DRSIAVWEAASMSYLRKLKGNLRSIGALAATATGGYAFSGSDDGTLRMWDAVQGDELT
                     ITKEERANAVQRVSEMDLAAAAPLPQPLVVGSTAVPAAARQSSSSVSFHGFHRGETEA
                     AAGREVRAGKSAVPAPRVFQRPLLTSVSASTSGFAAVSPPRRSTPLAVANGRHHRFRE
                     GNSAMEQSSLGRRAGAQRAPVVMRGACLLTEAAKGGGRASSLSASSLMLLAEVGAFEP
                     TETGTTLSAFREGSALVGPEGGMSPLRGNWEQEAELEDNDDKRAAIGSAAVADGRYRD
                     ADRRSFATLRTPRSLKRGIKKRAKSLQAKRDAGIASASSGRAATKTKAKSTSAAPAAG
                     TWAKRKKGAPKGATKNATLAAESTPVRTRWLASSLEQRLESWLRLYQQRVLLSAASMQ
                     LTQRISAGYDAVTAFNWPIECAHTECVTALAVVEDRLLVSASRDATAKVFALPSGQYV
                     RALGSSRRMPLSNVLYDASVGRLYTAFLDGGLAVYDTCSAELPLLSQMQSPYTILSST
                     FVQLRMTPMRRFVWMAVVRGEEAPGTSLNGSGGLSSVVLGAAQFDRTTMAHGPNQTAT
                     SYRVGQPSLRELNAAVSLQPLQQQRVRNLAQQATQPTNDMLEEMELSDMRRCGLVLER
                     EYVRRQSYGVFARWRQWAQRRALRSHSKAAIAARAESCAVTLLGRYTQRWLNWTRGRK
                     QTSASKVLREVQLQSSEVVLLAVCSEVLEGRLRVWTLVADAMGRQQQITRLACAYSRW
                     REFLRARQARLRQCVSFNKLLLSMNASSYTPASCTLAQMTRKATRVASQSTALWLLTE
                     QAQGSQAHARRRRCFDLWRACARQRRRVAASAAVGREWAVVEPLSSSLAQPWKLRRRY
                     FTLWQNFALYVTRSERLASERDTLGVEWATLQKTLEKPMSVRQLQEKLSAAESSTAAA
                     GAEAKLLEARLETVSSEMAVLRTEAALNMLIAGYRIPSVVEAATPLLPSAASAVTEVS
                     SMASLRRGSLASSTSTALSNGGGCSGAVACSHTPSITDADWTEEERAQRQEEDKVLFE
                     VSAVLRALKGKAVQYDRDDKLLSTAHTLALKLPIYEPAHRAQASLESSAGRHSRLLAQ
                     QPRTPRMLSAWSVSNAKSGGSTAVPALSSSSQQQQQQQHRPNRSAAGPAGSASPSSTT
                     VALPKTSATARRVASAAQMWAAQPTEETYACLADAFTVVYANLSALLRATALQCGAPA
                     RMVAGTTGAATGDNSTAHVGASWIAQVPLKQRRVMVGEILKLVTLFDSFTAHNDLPVE
                     CAGSISKRGRANTRAMPLCSLCSRDTATALLESASVLLELVDPHLWPLQIKLNHLQDA
                     YAAAIAELNATVSSAGFSDTAPHSSAVMNLNSAGSGEQGASPAPTPLVMQPPALRLSD
                     EVLQEARAAMLQHDATTLTITNPFGPVSVERRTNLSASSVRSGLTQATPLSSADGCTP
                     ARVHSTEEPLNTSKSLEEGRATPTTEPQHLRHRSTSHHSYLGVPTPRSYTPRAATLSV
                     AGAGLNGMLVKPYLGFRVNANRDTQTLRCTTISIREVTPQYVNAEGEDVDGPAQAAGL
                     QVGDQLVRFAGYAVTDLAAFNAVVSRHVRAGAELPVVILRSGEQLFKTIVVGSRAAAD
                     A"
     gene            <157261..>157716
                     /locus_tag="LMJF_19_0390"
                     /db_xref="GeneID:5651138"
     mRNA            <157261..>157716
                     /locus_tag="LMJF_19_0390"
                     /product="putative 40S ribosomal protein S13"
                     /transcript_id="XM_001682564.1"
                     /db_xref="GeneID:5651138"
     CDS             157261..157716
                     /locus_tag="LMJF_19_0390"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S13"
                     /protein_id="XP_001682616.1"
                     /db_xref="GeneID:5651138"
                     /db_xref="GOA:Q4Q3M1"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="InterPro:IPR012606"
                     /db_xref="InterPro:IPR023029"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3M1"
                     /translation="MVRMHGNGRGKASSALPYRRTPPAWLKIASRNVVKMVCKSSRKG
                     MMPSQIGMELRDSMGIAQVKNVTGRKILRILKHNGLAPEIPEDLYFLVKRATQMRKHL
                     ERHTTDRDTKYRLILVESRIHRLARYYKRVKQLPPTWKYESSTASAMVA"
     gene            <159426..>160268
                     /locus_tag="LMJF_19_0400"
                     /db_xref="GeneID:5651139"
     mRNA            <159426..>160268
                     /locus_tag="LMJF_19_0400"
                     /product="putative Qc-SNARE protein"
                     /transcript_id="XM_001682565.1"
                     /db_xref="GeneID:5651139"
     CDS             159426..160268
                     /locus_tag="LMJF_19_0400"
                     /codon_start=1
                     /product="putative Qc-SNARE protein"
                     /protein_id="XP_001682617.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651139"
                     /db_xref="GOA:Q4QDI1"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:Q4QDI1"
                     /translation="MAANGCFIAALIARTHDRLPLCSYTDDNYSNANVIRQQEQRIVE
                     RMESPAGGTDRAAAKGSYYESFDHKDNVYFAFQDAATDLTLVVAVNKLLLRNSGDING
                     MNKLACGLLDLIFSEFIQMYTPAEIGAPNVRAYQFIKFDATLRKCVTRIMQQDRTTGD
                     RIVIGSGTSGGSSGSGAGAGPSGGGVGATGMIRRQVNPQYDALRQEITDVHMVMRKNL
                     EDLMTRGEGLDTMTNYSAELVDQSSRYYKKTVQMNRMRLLKTYGPPAAIGLFLIVFFY
                     LYFF"
     gene            <161547..>161921
                     /locus_tag="LMJF_19_0410"
                     /db_xref="GeneID:5651140"
     mRNA            <161547..>161921
                     /locus_tag="LMJF_19_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682566.1"
                     /db_xref="GeneID:5651140"
     CDS             161547..161921
                     /locus_tag="LMJF_19_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682618.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651140"
                     /db_xref="InterPro:IPR008012"
                     /db_xref="UniProtKB/TrEMBL:Q4QDI0"
                     /translation="MTSDIGLPRPQAREERLMHPVEFIQRSAPRQEEALRMHNIRTTH
                     GLGAATEVALTEVTLLGSRRLGAIPTSNTLYNAYRGNFTELAPCDLYGLPENDPNVQP
                     TPRALVEKQFHGHELTMKTLGL"
     gene            <163389..>163844
                     /locus_tag="LMJF_19_0420"
                     /db_xref="GeneID:5651141"
     mRNA            <163389..>163844
                     /locus_tag="LMJF_19_0420"
                     /product="putative RNA polymerase III C11 subunit"
                     /transcript_id="XM_001682567.1"
                     /db_xref="GeneID:5651141"
     CDS             163389..163844
                     /locus_tag="LMJF_19_0420"
                     /codon_start=1
                     /product="putative RNA polymerase III C11 subunit"
                     /protein_id="XP_001682619.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651141"
                     /db_xref="GOA:Q4QDH9"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="UniProtKB/TrEMBL:Q4QDH9"
                     /translation="MFFCPFCSTLLLVVPHVEGNALVCATCRYVHSVASASPQVPRNA
                     FGEPILTIQHSFVAHNRQLMDAEEDPAMEAAASSSAAACHTTAAFTPVVKAETSAEGG
                     QITTIPCQNEDNPCQSTKAYFIQIQMRSADEPATVFFKCVECGHQWRQD"
     gene            <164943..>168332
                     /locus_tag="LMJF_19_0430"
                     /db_xref="GeneID:5651142"
     mRNA            <164943..>168332
                     /locus_tag="LMJF_19_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682568.1"
                     /db_xref="GeneID:5651142"
     CDS             164943..168332
                     /locus_tag="LMJF_19_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682620.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651142"
                     /db_xref="UniProtKB/TrEMBL:Q4QDH8"
                     /translation="MLSTIATEVSSFSVAPPLSVVGSGATGGVGGDSSVVPMTGAFPS
                     RHTRRRTSRLTVGNDDSVNQHSRTTSHLRTPSECSYGSSSARTLQSTLVTTPAASPLD
                     STISNGGNLQHHGNAHHHSRDGRGGAAPLFCSSSSSSGGKAHVVCVAEKQKKQLAVYV
                     VDRVSTSASGAVSSVRPSANEPTEDGGLGGSAALSTATARSSPPPRVVLRQHYVLPER
                     AQCVLMCSPVPAMRRGAALPFAGPVGALTSDGVPLLAGSVEAGLSVCVGMRREVSLLS
                     LIGGSTWCVLRLDGTRPPLLSVGSDHNTFLVRTQAPNTVMEVGVPSAAAMAGCVQDGN
                     AGWKTSTAAAAGANPILLRAGTARGAAIASETTSAAARGAALRSKDDDLVMGDVFQAD
                     TAVEFVLARFPHIFLFTAHHCDVVSLLEYGAGVGATSRNQRVPLPGIRYGALRGQGTS
                     VFVASDRTVWMLQLNPLRVQLAEMVAGGNSEAAFQLLAFHRRRAAAVARNAAAATDAD
                     DALRAVESDLHCMAGFAALHRGEVAEAIRFLRDHVDPREVLLALPECIPPTRATPAAH
                     DLGSGAPVRQAGVDVYVLDHVVTISSEDVYDALLRQSAVSAGAEAAAAQDTTGTHPSS
                     YWDSWRGPCVYNSFGGNVADAWRAAFTPGSSSSTSTGTVEDFVTSRFDLLKAEVRAWF
                     AEELLEPVSDASVIPSAATSPTAATRTSIDRESMECSGASLPIATATTLLLPPLTRLV
                     AHRRAMEYASLVLAWEARDYRMAHQVVASVSKALRVEDCADMLRHLREYRLLAVLQFR
                     TGQGEACRATLRNLVSVSAVLQLRHGHAAAQTTPVASQLSHWRQCMATLTAQRRCNGV
                     AAPQPTCGRGLLMLPSLAAVARVAHTLFDIEVPFNFASDDSAREALLRGIMSYYETHH
                     SRVATASAAAAEHGEASYCELRFSVCGTHSSGLLSFPHTGPLLSTVVDAAAPAPVPPH
                     AAVQSQSEAATKPGSTAARRTVVRAVPSALTAFFYLVEKLDVAGVKQLLSRQPRLAQL
                     RDEEGGTALHVAMSQLDLVGPASTRDARPSDSPAPAMSLLQLLCSLNGLLVHFGCPVG
                     LLNRYGWSCLDVAAVACAGNTTAFDIVTAALLAAVEVRAVA"
     gene            <169114..>170166
                     /locus_tag="LMJF_19_0440"
                     /db_xref="GeneID:5651143"
     mRNA            <169114..>170166
                     /locus_tag="LMJF_19_0440"
                     /product="putative nucleosome assembly protein"
                     /transcript_id="XM_001682569.1"
                     /db_xref="GeneID:5651143"
     CDS             169114..170166
                     /locus_tag="LMJF_19_0440"
                     /codon_start=1
                     /product="putative nucleosome assembly protein"
                     /protein_id="XP_001682621.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651143"
                     /db_xref="GOA:Q4QDH7"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:Q4QDH7"
                     /translation="MPPKNQRDAPVVIPDEDDEGDMMEMGNMLDFQKYLDPDFSKNFM
                     ASLPEKIRQRAQVLSAYDKDLSAQQKAYKAKEMDILRRYDALFEPLLQRRKEIVTGAA
                     VSDEEVKKGMPEEHVNVISVEVDETDEAAKAADAFGLEGFWLRVLRHHAVIDSTIEPH
                     DEDVLKHLVDIRSSVAEGEYGSFQVIFTFSPNDFFEEETITATVSIKDDKSELTVSPI
                     TWKPGKNVMIHTVTKKQRAKRTGQVRTTTRDVPQLSFFWLFKKKTEAVGDDDAEKDGE
                     EDDEEQRISMLEVLHTCIVPNAVRYYTGEAPNGFSDVDEEDEEDEEEEEEEEEIIPRG
                     RGGNRGGRGGRGGRGI"
     gene            <171615..>174464
                     /locus_tag="LMJF_19_0450"
                     /db_xref="GeneID:5651144"
     mRNA            <171615..>174464
                     /locus_tag="LMJF_19_0450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682570.1"
                     /db_xref="GeneID:5651144"
     CDS             171615..174464
                     /locus_tag="LMJF_19_0450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682622.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651144"
                     /db_xref="UniProtKB/TrEMBL:Q4QDH6"
                     /translation="MSSPPLAYPSTGEFNVLVQRFKLLNLVQRVAHRDVSEMLDTVGL
                     EGLSRKGMLTRWAWSGAEGDDGDASIDPKVLGQEGAPMYRFEQSRPRASPSTRRVSSP
                     VSGRPISLPRMQFGRPASGFDARIAAARWNSGIEEYSSAADSIRRSYTSTRQNAAEEA
                     DAAARLTTKRRRYVVRRTHRVLHRSRSERETFFSRLAEPRQRPGALVEEVLLCDEAVP
                     PAHGRRGDDDARSWRDAADRNASEIAEHDRRGRYGGDTYGGRDGGVFTSAAPATMQRR
                     PSLNAYAYHHKDLRAHYYAPLQPSASPRHWAAAGASDVRPGEKPAGELDDYEATLPSP
                     TDPVHSQCNVSTDGDPHEVAFTPPPLRFRSTGASSSPLESPARMRSRNFASLGQGDAA
                     AASPTDGERHEDQSTAVEFVRKSPTAPAVFMSDDGVVKSPFTGDDIQSFAATAPTVAL
                     PRGGGSGAAAGDAPTVLELHLPQSRPSGGDGFVLVDAGQRSSSTSGRIVFADSETPRA
                     AAGNSGSTSTSQVLKSPRAARGLAPKAKPKGAVEGARVPLEAVRHASALLSGSGSFHP
                     SPTIGSRGGSAHNSYAAAMPPLQQLHPSGTRTPPAVSGFGGGVPRSPRPHTVTVQAGT
                     AGGAGVAADYNMPKGVTPLTVFRTAASPLGSMPHSGDFAFTDSLTGYQVSAATKKSFE
                     ELSSAIDHMLLDHQQLLRQVYKDTHVTSREAARQPGSFPAASRSSQNAGTVPASDEAS
                     SHSSSFEVASEGLAEETAKAAGYAGSVDTTIGADLVSDGATGDVDVQLYALSAEAEDE
                     MLLYTQLQHQLTQLDADMVRLGLDNANDAAAEGSDGATGDRARGASPLGRGTPLLQPS
                     SPTTVTVQHPARPPRARGEVPEAIVQRLCAYRMNNFQYIAYNERLWNTSSISQFVFAQ
                     RLTAALIEECWSEVMAEVGSIMDEYVDGLADHELQ"
     gene            <176423..>177310
                     /locus_tag="LMJF_19_0460"
                     /db_xref="GeneID:5651145"
     mRNA            <176423..>177310
                     /locus_tag="LMJF_19_0460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682571.1"
                     /db_xref="GeneID:5651145"
     CDS             176423..177310
                     /locus_tag="LMJF_19_0460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682623.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651145"
                     /db_xref="GOA:Q4QDH5"
                     /db_xref="InterPro:IPR019309"
                     /db_xref="UniProtKB/TrEMBL:Q4QDH5"
                     /translation="MATSALPPNSTAALVSANAAAVAEADADAQAVAVLVNRFVISTV
                     QFLNRFSNECESRLVQTEESLQQLELQTQLLEHLLITSGAADPEADEAEDEGGDHSND
                     DDGGASYLADGDDQGMARDDGSEASAAYHYRQRRGRGRRSASENGDAESVFGLPAPPL
                     NDRRSGGPPPPPGNYHKGPPRPPPGVARATAAAQEAEAARVATLAMVGAPVLMPPLSG
                     DAPAPPPPLELRPGRLLMRNHPRLHGYFELLSLRVPAAFVKAKMQADCFQGEWLDTPD
                     APAPSGLSAAVRAFVDEPD"
     gene            <177978..>179060
                     /gene="CBP30"
                     /locus_tag="LMJF_19_0470"
                     /db_xref="GeneID:5651146"
     mRNA            <177978..>179060
                     /gene="CBP30"
                     /locus_tag="LMJF_19_0470"
                     /product="putative nuclear cap binding complex subunit
                     CBP30"
                     /transcript_id="XM_001682572.1"
                     /db_xref="GeneID:5651146"
     CDS             177978..179060
                     /gene="CBP30"
                     /locus_tag="LMJF_19_0470"
                     /codon_start=1
                     /product="putative nuclear cap binding complex subunit
                     CBP30"
                     /protein_id="XP_001682624.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651146"
                     /db_xref="UniProtKB/TrEMBL:Q4QDH4"
                     /translation="MSSSSSGQYSGSGGNRGSGFVHLNTPASIQYTAGKTLSLSALRQ
                     SKSRVECAVLPESMSVWRDAFQRYSKEEGYSSFAADIEDERTGNGPILPPLVPQRAGP
                     VRRRAGRALVRTDAFFCASSSPAPLGTSASTAHTGADRPPLTDGAAAISSTATAASAS
                     SSSRLSDKGTTATSADSVADGSTGPTAKQQQEGIPIVSHHKLLGRQQFVYPDYDGVLS
                     AGVVPQIVVTAEEEAEEAAAKAFYISPLTMTEEELAAFEELQGLWKSRARSHSFLGAQ
                     HRKAAKGAVDPSSSADVLEAGGAGLPKVRRCEGVTGGASLSARRGNEIDVPAYAEAET
                     AVEEESKLDKELSEALRMADDLLRFA"
     gene            <180596..>181114
                     /locus_tag="LMJF_19_0480"
                     /db_xref="GeneID:5651147"
     mRNA            <180596..>181114
                     /locus_tag="LMJF_19_0480"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682573.1"
                     /db_xref="GeneID:5651147"
     CDS             180596..181114
                     /locus_tag="LMJF_19_0480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682625.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651147"
                     /db_xref="UniProtKB/TrEMBL:Q4QDH3"
                     /translation="MAEEIVTGLHCRLDVGHPSSTTRCRAAHQSPKVQLIDFITSRCR
                     PVRYNDAGVPVEGSLLLLPWREQLRLCTAILAAFYITKALFDVVRFELLYYGVWKVGY
                     RNDGSLLKRLLYYGSTAMLAAGLLFSFNVNFFLSACVVGRREIALHTLCNVFTYVMPR
                     RLLQPLVRRTVC"
     gene            <185418..>186062
                     /locus_tag="LMJF_19_0490"
                     /db_xref="GeneID:5651148"
     mRNA            <185418..>186062
                     /locus_tag="LMJF_19_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682574.1"
                     /db_xref="GeneID:5651148"
     CDS             185418..186062
                     /locus_tag="LMJF_19_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682626.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651148"
                     /db_xref="UniProtKB/TrEMBL:Q4QDH2"
                     /translation="MLARLSLNCIITPSASASLRRARPSLTVSAHQPLRAAQRRCATK
                     AEAKASTKAEQQATSAFGGAAEAKVTSQHPISHGPQRKDWRTHKEIVYVKGVPAKGSL
                     FKLPLAEQLIICLVFSIAGSAAVYLVRPQIRYLCHHGFLGLTDEAGWKNGPWLYRFMY
                     CLIMFPSYSLILFVVGGLFGRRIWFSFMIHKMWSRFLTRNASRRLKHLLDLQHY"
     gene            <187229..>188128
                     /locus_tag="LMJF_19_0500"
                     /db_xref="GeneID:5651149"
     mRNA            <187229..>188128
                     /locus_tag="LMJF_19_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682575.1"
                     /db_xref="GeneID:5651149"
     CDS             187229..188128
                     /locus_tag="LMJF_19_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682627.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651149"
                     /db_xref="UniProtKB/TrEMBL:Q4QDH1"
                     /translation="MEDTINVFGRGTPAGEAIYRCYVAPSKPSTLDPQLAALLARRRQ
                     EREAAEAAQAHPKPIPKSKAPVHRPRVGMGKRPTEEEYARWRLQHIPHRRSKAAIEAE
                     EEAHRWVPPPVSERFARPAITDAEKDRLADVMAYGAELPKPKEFTGVQRARFHRLEPR
                     AELEDRFTKLRQTAQEVQSELAQLRQSAPGAGASLPSGGRVVESVSDPQARLSQRRSC
                     GGGGDPATASPCPLASAASPGAAAARDVLSIGGTRVGRQGDSKMSTIERCRQERELQS
                     HLGTVIAEMEAVDRELNRLPISS"
     gene            <189450..>194261
                     /locus_tag="LMJF_19_0510"
                     /db_xref="GeneID:5651150"
     mRNA            <189450..>194261
                     /locus_tag="LMJF_19_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682576.1"
                     /db_xref="GeneID:5651150"
     CDS             189450..194261
                     /locus_tag="LMJF_19_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682628.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651150"
                     /db_xref="UniProtKB/TrEMBL:Q4QDH0"
                     /translation="MSRASDVESLLLRFLEVEDGLHRPTARHENAPLLVKMTSSATPV
                     DEAVTVNGHQARRSCSVTEAPAQATACCEMATPSSSHHDLRRPNTSSSSASSDTQGEA
                     ATPPRRSSSNQHVITRTALDTFARPPTPRNSIPGASPSPPLSLSHPVVQFLTSVQLQG
                     YADRLMCDLGIQSLPDLVKRSAALKDVTALLGPSASLQQHNELLRGLRRWEREEARRA
                     NAEAAEERRRARKEDRPTKGAAKALGTHKSRSRAAQTTVQSVTTASEDDGGRASGRGS
                     GTGGGRQSTPLVAALDSCVGMCAAVCFRLSDVCDRVLQSHTSTTALGTTEAAPHELSG
                     DSGNVVVSSLEPPPFPASLSMSSSSRPSLTTSATQLMRQLSYRCSHARLAAARRRRAG
                     WSRSYRNVRGDQGEPLDATSRTATKVAPYDVDAEDLDAVTTSGASSRSGSNHREVSHA
                     SEVSCQLETSEPPAEGDVGDDADAALSDEESLPRCAQRASVASAAGVERCEAVEESSN
                     AEALLLPAALSSACYLCESHLSFTLCSLREAAEEQTAVPDLNGSDGADGEGPASTQWA
                     PAVSDTPCGAFGDVLTGDGRATDESHHPIPNGLVATSNISLSALSARAEVQVLPPREP
                     AVTLVRAKGSPVAEEAGRTATADAHTTAAQYPVLGSGTTCNASQHHQSLNPVALTHES
                     AAQPRQSRATDTLLETTGASVVTGSAPEARALLEKRLADARRRLNDALQEALQSYNAE
                     VKAIRQATAVPHTDTAIVKKWVPLRAVLQPIPFSPRASSACARSAAAAKLSTPAERVV
                     WGLDAEGDVDSGEIHWCASPAPTAAVSAGAEAEVPATCSPAAGAALDCVCADDRKVLT
                     AMASTATSARTTVSFTAAPVAPSCRSAVTPAATVEGDGLASTGALDAPTAAALMESRS
                     GRDKEREEDGNVSCESVGRLTAGTQRLSTHVNMGAAGKAAAIAAATPIDMVAAEGRGD
                     STAAFLWVSQDSPSRTRQGPYADAAAADSDREENVSTSDEWWAAYGIDALECTQNSAD
                     GVAGGWAAAPSTNSVHPHATSNGNGAVSTSRVCTPSPAPVEVIELTSGTDDEDADSRD
                     ARSRPPHASSYLPPPAAPSLLLPTSPPPRDGLSGGVTIPSRTGPTAPMHSWRPLVLDR
                     RLHADAWPHMTNAELRQLCFEFGLMAPSPTKGDTTSPFPVAAAGSPRILGRRGRSAPL
                     PSSAAGSPACARKSAVSPASSPERDLFGLPTLPTVVPAACRESSHTAAKTVDGAPPPP
                     PPPPPEPSSPVGAFTQPENGSGGGGGGRAAVAAAAAATGVASEHVDIRQRDQRRATLL
                     ERESLLEALRLLATRLRFRHTVAPFFLHRVARLSGLPYKRMRAADLLDEGAVLTRDDL
                     KQTRLRYKAEEQVEVERCIASALVAEAAEAIEQDAQRVTSRWATLPLFAVEGGNSTKM
                     KVSPARSALASLPDGGVRCCYDQILLREPVNVFAAVSAVQRSFPHITHTRVQQLLAAN
                     EVTAEAVVTVSSRSPSPVPQLATTGQLEAGQAMAVPRPSGELTIDATPSIQQTGGGDI
                     PFHRGSGAVHSPATTTPLSQEDRQRVNARRYFAQRSYMIRRQTGGRGGGRR"
     gene            <194735..>196444
                     /locus_tag="LMJF_19_0520"
                     /db_xref="GeneID:5651151"
     mRNA            <194735..>196444
                     /locus_tag="LMJF_19_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682577.1"
                     /db_xref="GeneID:5651151"
     CDS             194735..196444
                     /locus_tag="LMJF_19_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682629.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651151"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:Q4QDG9"
                     /translation="MSTVFTTNAWERSSPFQPNGAAHTDSNSTMDAGKLSSVGLPCGR
                     GIEEVAAQNGQPFSHSADALPAARGPVTETDVMMDSGAATVECALVLAESNKCGAVVA
                     AHPPATFPGFYEDVKYSVRTLFAPPKPPSEMPPRVKRQPRRGPVYDNDIAAAGERQHR
                     AQREVSRMWRGVLCRRRLRQARTLAEVLNNRARCIQCWWRSLRARWRLRQLRAIRKEY
                     AKELTARYIADRVENTKNIIFWQHCRYEDAAVLIQRALRWYLRGKQRDLYKMEGLPES
                     EWPPALERPSTRKRRPFFAWRCPRPNANAIGGALAADELSDTDDDALHHRTLLQFRAV
                     RDPVPPPTQKEVEAINAKTRERIAQREFALTAPEVLSRAEWKTENIRNEDLDFNAGVL
                     QRLYRSKQAPIKARARQLTGEYFDKTARIIVRALRMQLFIRRMRKHRARVEGEVKARM
                     ARHDAEKIEALKVEAVWQRELMDASAACIQRCYHWYRFERDGVVPASYAAINAVPRAP
                     PYGLINEHTQREREMRWASMNLMEQHELEKQRHHMYLHYVPAKTIVCKCTGRFAATPQ
                     SEL"
     gene            <199547..>201787
                     /locus_tag="LMJF_19_0530"
                     /db_xref="GeneID:5651152"
     mRNA            <199547..>201787
                     /locus_tag="LMJF_19_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682578.1"
                     /db_xref="GeneID:5651152"
     CDS             199547..201787
                     /locus_tag="LMJF_19_0530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682630.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651152"
                     /db_xref="UniProtKB/TrEMBL:Q4QDG8"
                     /translation="MGPAGALHTHAANGYHSVASEGMTADDSISSAAGVTESSSAAQS
                     TAAVPLMHSIGRTKRHRMVSSADTQHSLASSTLPLPRCHRTSGHGSVDAESAPQRDVC
                     FDASMACALPSSAGRYLSDEHDEDADGAPKRCGSGSNSSRCSSRGAVSYSASSIRARV
                     AGVPEKLDMITPRAGQRAFDDSAAGAQCLVIEDSVDTGAVVSPAQLQQMKAEAAGGGV
                     HRRASDEFSTLYESRLVTADVLRDWTGWEDLDLVLTAQLRVDADAMIGVDQIGAQLSS
                     LSSLKLNGSRISRVRQLGIGFHALKYLWLNSCHVTDLCGIAACCPSLVELYVPFNCVR
                     DVTPVMALSATLEVLDVEGNLLDDAADLGAVLTSLHGVRALSLLGNPLTCEYQARVRD
                     AYRDLLVEGGRSAGANTAASDEALSPVLPPIEHKPFSHVLAAWVRLLMPQLETLNDAA
                     IDVSVNSSCVSFPLHSSSSEEASRRLAVPVSTHVDPLDDALAEELRLVEECARDVDAF
                     DALLAAVDEANRHVYTRPSTSCGGAQPRLAPRTAIGVARPFTSRWSRAPVRLASCGGS
                     TTDASVLTTGAVLAGNATASLRRRLATPSMSFNDAAQDDPSATNSSAADPAGRKGTSA
                     QQSGICEKDSRYCASVTATSTSDLDEDARIAALLADDSEEEEWEHFKASLLRSQSTSA
                     ASMPRLGDPMSTPAAAAASYHQLLYTQNDEAAATASTLQADGFEKELRTELTRLRMRI
                     AKESRE"
     gene            <206074..>207279
                     /locus_tag="LMJF_19_0550"
                     /db_xref="GeneID:5651153"
     mRNA            <206074..>207279
                     /locus_tag="LMJF_19_0550"
                     /product="putative methionine aminopeptidase"
                     /transcript_id="XM_001682579.1"
                     /db_xref="GeneID:5651153"
     CDS             206074..207279
                     /locus_tag="LMJF_19_0550"
                     /EC_number="3.4.11.18"
                     /codon_start=1
                     /product="putative methionine aminopeptidase"
                     /protein_id="XP_001682631.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651153"
                     /db_xref="GOA:Q4QDG7"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002467"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:Q4QDG7"
                     /translation="MPCEGCGVGEAGLQCPTCKKLSLPPSFFCTQDCFRAHWGTHKLK
                     HTETKNLPATIPTMTEVDERLFNFTGPLRPGKITPRRAVPKEIARPDYAERNDGVSEL
                     EEKDRGSLRVVAHSLKNLHEDYNNAELRRSSDILKIKRVNALSREVLDIACAAVKPGV
                     TTDEIDRIVHEATIERGMYPSPLNYYNFPKSVCTSVNEIICHGIPDNRPLEEGDIVNI
                     DVSCYLDGFHGDLNETVFVGRPDEESVKIVHTAYACMMAGIGVVKPDELYRYIGDAIE
                     ARAKKSGCSVVRSYTGHGIGKFFHTAPNVCHYKDNKSPGLIKPGHVFTIEPMINLGTW
                     QDVTWPDNWTSATKDGKRTAQFEHTMVCTPEAVELLTDWKDGIPFYQKQLREWGIPIP
                     AEDPSEIKI"
     gene            <210535..>214680
                     /locus_tag="LMJF_19_0560"
                     /db_xref="GeneID:5651154"
     mRNA            <210535..>214680
                     /locus_tag="LMJF_19_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682580.1"
                     /db_xref="GeneID:5651154"
     CDS             210535..214680
                     /locus_tag="LMJF_19_0560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682632.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651154"
                     /db_xref="InterPro:IPR010441"
                     /db_xref="UniProtKB/TrEMBL:Q4QDG6"
                     /translation="MQREVIKWVQSLDLSAPIQNPKRDLATGHLAAEIVARYSGTKYL
                     DLERLPMGAAAATKRDVWSQVHRALQQLSCTTVTQPLIDAVLRREPNAALTVLEYLYE
                     HFTGHTLPMHGLDAVGTSKDAYVQPRNATSTARLLEVTSGKPNNNFSSSVEKVTLTAK
                     KKLFDPVTSASQLTSAARSSSAADVRFAAQDTAADWPDGGGDASGNDSTRALQHRLAL
                     IDNSELAGGANALQAYPRYARPTASTLVHTASGSRKDVVLDKPKYAVDEVLQQQQNER
                     ILHQHAVVQRLQEESEGATVEGPSRTRTGASAVETTTPSLPTSPLREKAALHANRDAA
                     AAAPLTTLYRGRFYRQPDAPTVTGTAKVSTGPRKAKKGKREEVATKAQRGTAAALPKD
                     HVIDADGKLDRHAAAAFGDILSTREFAGSTSGGGGTDGARVVPVLRVNVHSTSLQATL
                     ALRSDHAELQERAAALSLEHFAKHNYALRPGLSDILVDVLIAHKQLQRLLDCCVEDGN
                     SEVLDNVLGHLLAHRDEFPPACIRACWQALVQHADGIVAVLQKNPDEYGYLMESLAFA
                     FSREAAQVPLLHISQTVPVSGEADDAEQEEGAAATMGGSPLLPFFGSTRRSIAFSSGV
                     VAGAGHTAAAAARGCSPLPGEGSAAEGDTASPRHRRSLSEALLTATHRAASVAAGSFN
                     TPNSASLSSRQRAIIDTCNGLPVACAFGFLYRIARQLDVRTAAYVLERYVLRSTKPFL
                     LRHGTVAVREAVARVMSASFVPAPPPNASAAINAESNGEAVAAAATDSEEAFVQFLTG
                     KLARTLLGPFPTAGNTHCGAASTPLCDSPDDSEAKHETHSTLPLQLSLQRAYWLIVFH
                     AVADYPCTADHGMAASSGPDGPLAACVRNAAVTCLSCTNADLLTIGVGLTIEYSKRWL
                     PRDVPPIDAAVDDAVASGRDLLSHVLPSLDAAADQLATPWWRTRSANTWECRLMVLRL
                     CNALLAHPLFAGAGSPKASAESCSDGGKATSCDWRATIDAAAAECLWTFAEGPSWQLQ
                     LALGVAAKYIDQTSAPTLTDTWRQLLCSIPVASLPTQLLPYDEAPVRLRLLRPLRSAA
                     SVTEAAESDRSKGAQPSARPQQVRMSSCQNNHAARLHSATSAFAGEPESWMWTPAREN
                     GDGWRSPGTGTATSATAEAALHFVWGRVLSVYAVMPLNQTWNVQGVVDAVLPPLPANG
                     GTTAAPSPPAAPAMAPGFQLLVMAAALLSPPATATTAVAAAPSMASLHKLSLMSPADA
                     EPVDVGELSGAFWLAALRRAWPLFQACGVSHEPMTQGSNTNITEEAASSLGGVAVGMA
                     GSGVNLEDLRTIVLSLFLRFADDSAVASAMAAADGDGAKLCGSAIRWAEAMCSDAPAT
                     YAQ"
     gene            <216569..>218215
                     /locus_tag="LMJF_19_0570"
                     /db_xref="GeneID:5651155"
     mRNA            <216569..>218215
                     /locus_tag="LMJF_19_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682581.1"
                     /db_xref="GeneID:5651155"
     CDS             216569..218215
                     /locus_tag="LMJF_19_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682633.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651155"
                     /db_xref="UniProtKB/TrEMBL:Q4QDG5"
                     /translation="MVCPFSCPPLPAPSLNSSHLSLPKKQRLTARAHTPTHKMAKTTL
                     LVCALLALVMCLAATAVSAQQSLACQMVWQAPSPNNSLLECLGNTDRIRSQWPYYLYP
                     AFAALIFIFTVIGLPILFCCHCCSCCEAYVKPKAETDLGVARCCLWMLIVISVLVACG
                     VCVLLVYGSVLLEQAATQIIHDTEYRTLNYFNDIRANITMLLTNYSADPPIPPSIDLR
                     TFDAVNDDITHYVHLARNNYLQYFRAAEIVVCCVGSVGVFLMLCMLVFVLCRCNGICP
                     IAWSCLYFVFALAFALLAVLFTICIYVLSAGCGEVGLQRGREPGVFQWYLVPWCEKQF
                     NFQALRAQVQSQEQQVSQSACAELLNFCDNDPHYSLETKNHIFMCGNSITDKSQCDSL
                     DDVVDVVLSTYVKPMLTNTLCANQTGMEYLEKCTVRLCSSRCVNYEALDLHARTYAIQ
                     ILQAADFAANASTALSYVWPLLDCNFIIDKIANTVETQSYNSSFTTQSEYVRSCSAVR
                     TSSVMLGTGFFVGALMFIVGIYVIHRGSRITVPVNKEKDF"
     gene            <223522..>225114
                     /locus_tag="LMJF_19_0540"
                     /db_xref="GeneID:5651156"
     mRNA            <223522..>225114
                     /locus_tag="LMJF_19_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682582.1"
                     /db_xref="GeneID:5651156"
     CDS             223522..225114
                     /locus_tag="LMJF_19_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682634.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651156"
                     /db_xref="UniProtKB/TrEMBL:Q4QDG4"
                     /translation="MAKTTLLVCALLALVMCLAATAVSAQQSLACQMVWQAPSPNNSL
                     LECLGNTDRIRSQWPYYLYPAFAALIFIFTVIGLPILFCCHCCSCCEAYVKPKAETDL
                     GVARCCLWMLIVISVLVACGVCVLLVYGSVLLEQAATQIIHDTEYRTLDYFNDIRANI
                     TMLLTNYSADPPIPPSIDLRTFDAVNDDITHYVHVARNNYLQYFRAAEIVACCVGSVG
                     VFLMLCMLVFALCRCNGICPIAWSCLYFVFALAFALLAVLFTICIYVLSAGCGEVGLQ
                     HGREPGVFQWYLVPWCEKEFNFQALRAQVQSQEQQVSQSACAELLNFCDNDPHYSLET
                     KNHIFMCGNSITDKSQCDSLDDVVDVVLSTYVKPMLTNTLCANQTGMEYLEKCTLISC
                     SSRCVNYKFPALDARTYAIQILQAADFAANASTALSYVWPLLDCNFIIDKIANTVETQ
                     SYNSSFTTQSEYVRSCSAVRTSSVMLGTGFFVGALMFILGIHVMHRGAFIWAAGKKNG
                     AVQKTKDVSPPDNAASSNPRTP"
     gene            <231309..>239675
                     /locus_tag="LMJF_19_0580"
                     /db_xref="GeneID:5651157"
     mRNA            <231309..>239675
                     /locus_tag="LMJF_19_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682583.1"
                     /db_xref="GeneID:5651157"
     CDS             231309..239675
                     /locus_tag="LMJF_19_0580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682635.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651157"
                     /db_xref="GOA:Q4QDG3"
                     /db_xref="InterPro:IPR006599"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR012945"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="InterPro:IPR027684"
                     /db_xref="UniProtKB/TrEMBL:Q4QDG3"
                     /translation="MMAASASTLTDTERTGTAGASFITSSASPMTPNPAVSYTRVSKS
                     PAAVWSAAATVLPASQLPTSPSPAGSLPCDPLLPHIAPAAAGHGNAVYSSFEAASGEE
                     VDENDLNSSAASRAAQAALDAEEQLRGHEGPSDSSLVPTALSERSSSVAPPQTPARKK
                     VSAPPRPMQVHACEDEMDTSTSVFHLDEEKDCDGSVAGMLAGSSVALVHTTPSDKRPL
                     VPREERSDLDGAAANSSGDAGAVSHMATWRRQPPPPPTPSTATKKSPSASSAMRHAVE
                     SDDTTSTSSGGSPHCTNLTVEQQNTPVIAQGTVTTLATSVDAAQAVVHYTASTLPPDR
                     SSSSGSDSPAFISGKNAGDPAHKMHSRADGTHALSLQHQRVMEYSGRPEEAAVGEHVG
                     SAMMLSTIATEGGAVKIRGSDSEGVAAAASVPGLEQHPPHHGLKPLSTDQLNGETKTR
                     AADPAALTTGGETSASRASTVLMPPSPSQPRAAAILDNSSFSSPSCGDAPAAATAALA
                     RQSGRRSSGQALPASEGDAAAQSSKSDVVRRALVMRCVQDSSTSSSLSSSSSRSVSGH
                     TKGPRQALVNRSTRAAGGEQTSVESKGGGNNPRVSPSSSALCVDAMCAKDTSATHARA
                     LQYTEALDGADVGENEEAEEAEENGAPPINWDGAEEQESNPLLLQEAGRWDAVLEEME
                     LVDCTVVSRVYQRAMPLGRTASHSTSEDAGDNMGSEDDDELCLFKVVSLFPIAADHSE
                     RWGRRTRVQKCLLALAEEMRATQRALDEAGLTEAEAEPGSSASQHVGSSAKPPANGEE
                     RVGGHEDDTGDVFAKRRRRTTCAGVSEVYVDSRCRLIAQLEAVPYMVPLRHLVAASSG
                     TGLRENEVLALIRTVVCKAATMHNAGFVHGALHAGNVLLSSYDGDAVLTQPCGLMSQS
                     SWLPTDLSVISVARANAMAPYLSEVWGARRLQVSGATSTRLGPPQRPDTAELITYHNL
                     AALGWLDDDDARKAGGSADRRDSAELCMAGAAYTPTAADDLYAVGMIAFLIYVGVPPF
                     QMASLWAVVERLRALGAAYRAAMQSSASSSASAAARQEARRLVAEFCFGTRRRGAGAG
                     DCHRHGVARFRPDFEQALESFIVDCVEASCSAATLTHASGTPDESGAGPHVYADAQEL
                     LTRHPLFRCLSLPAHAGQDDEEEHGSGGGVRSSGEEESHQSVDERMRDTVHRVAYPAF
                     CTWARAREDCGSAPHLSRLHSNALFTARCTALCECVSATVTSYDDERSESQNAAEDGE
                     PWSSLPVISPHVAGALQAWHFPFLSAEAGTSCLNGRETDTRTCTVSSAEAAAATRPRQ
                     RRGDARAVTGPARHQCLPSLVRPTASAAPAERAAAGDGDDGADGDVSATTLAQQEEDA
                     LAAQLFSGEQRQADGDFVHQPHLHALTLAGKQQSAFSLSRAFVLSRVLPVADTLVLQH
                     LTDCTVTLLAPFRYIVLDGLQRCEVRLGPCETCVLRDVHDCPLIAVAALQLSGNNVTE
                     THLSWSRQGSGRPLLKCSRGITASLYGLMYEGLVEDYSRVGLALEHAACFVAADDVNE
                     DSGEVDGAVTFRGPALACPRAVELLATTATSASGSQREVALCLAPEAPYDLALLLSNT
                     RYVHSGRPSVGLQSPRIPSPDVFHFFGELAEKDVVVCDVRGGTRDGDARPVIFLVGVL
                     GDIVIERCSHCTILVAGTPSNLQASQCHDCQLIFMARESVVENCARVECVALVTEYLL
                     VRECDAVRVRPLFLDCPFSDEVLRCVVGGSVGSADEEMVVGAYEAGRLDELNAVLRGI
                     GQGVLVEASENVVIEDIGYYYNRSGRVGDGEREDREGGADGDGFSVLSVAYASMQSPT
                     AAASSSGNASRFMAEAAQSLAEHLSLPCYLEPLQRYGGGESGAASHADRPTVSFHDLL
                     NCSVLRLCGSLCPLESQASPTSCDSTAELADICVERVHGGVLYVEDAVGTLCLRHCVG
                     PLDIVVCAAARVIMEACVGVQLRTACVDFRATDCVHCHVALHVNNPPRYQRCRNVQAS
                     ALNITARDFNALLSAAGVDLATNLYDEPLLLTEEWKPTVAAGMSGALLEARGMHALRG
                     GCVDTPTGPHSTADMCAVLLSSVPREQLHPRQGGPRDSRLRVRPDQVLHIMTVLRQPV
                     TVVAPLPGLCASPNETPFLEELEARVAVWAKQPLSVSREEAVAIALYALADLAEVYAS
                     VTEWVEATDAVQPTEAPERVAAFGGSWNPDTPPHLLSTRAPPSLPAASSASSTTVSVP
                     GLALDAVQQRLPSTERVLLQQPCTKDGGCAAQDASAAPSSSLSAGDASGAEIRTPAKP
                     VLLEVGVVEIAPGTEGFVEEVAVHSASAPPLSSPLTCYTDPAPAPENDGARTSPAEGP
                     HADPVALHRPSQSDSLPMRAQHGGLTAAELPTLPCTSASAFASSATVLDGAASGMEDD
                     TSVNSSVAPPPLPPGPAYALNPTNVGASSTMDVFCRTQRDAASVARGTAGPLMEEEGG
                     AYSLTARMLDDEGVGLTSASPWPDDICSPVVKGSHRALEWVMESGDNHEGARSGRQAS
                     PVAKTINVLGAQAQAQWPSSLERSPHVRASEERSSRDGDELLVATTAVSAKDMQEVFL
                     KAEDEPHYTRNAAHSSLRTSASSVAEYPWRGVMSYKNSAEYVAGGSDSGTGETAVPQT
                     NFLHVSQDSSARRLELNSHAATGTPVVAMGSDEGGSGEDGSFSRAQSGVLGPPASERA
                     AVRKMEPLGRLSPEVMAMRDVDADVKEVLRQVEQARQLFARNQRSWESSAGGGLEARV
                     RAAVAKLTALKAAHAEAA"
     gene            <246139..>249753
                     /locus_tag="LMJF_19_0590"
                     /db_xref="GeneID:5651158"
     mRNA            <246139..>249753
                     /locus_tag="LMJF_19_0590"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682584.1"
                     /db_xref="GeneID:5651158"
     CDS             246139..249753
                     /locus_tag="LMJF_19_0590"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682636.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651158"
                     /db_xref="GOA:Q4QDG2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QDG2"
                     /translation="MDEGDVSAASALEVPMTPQSFSTMLLARESNEGAQHPVRASSAT
                     SALTTTTNGARSSSLAVLEGNDTMRRPSSEQVPIVSQGAEDAWSGGGVAANGIEDWCV
                     DGGSRNSRETRTTGTTLTSGVGPHPCLVAGSGSAGCVMGGRYATSLSSFQLLGGTSQQ
                     EMPTCAIDTDEIPSTPTDISALPHPPPPLSARRRRQRRACHHRDGGSAVSSNSRVDSE
                     TGVIETDTLERARAVSKDGARAYEIVNGKYVMYDYELGKGSYATVRLCYNLADGHFYA
                     VKVLDRVRLKRRQLGSEADLCKIDQEIAMMKQVQHKNIIALHEVIRDPSMRYVYLVLE
                     LAESREVLSMRDNGEVLPRGDDDDAATAYPETAAREMVKGLLHALMYVHYLGVAHRDI
                     KPSNVLRTADGTVKLCDFGVSVLVGDAPMQLSREGSVAFLAPELLLSSEVNVSRFLTP
                     EDSSLGPTRNKSAAHMLGDAALASAAKNACTTMASTTAATSATQLASTGGPTPQKEEG
                     AKCTQRLTSSFSGAALQPSAHAAASRAPGREITSSGGGAPSAISPWPSSTSLPQRSGG
                     GGVARRASFRTFSLSPCGAAARECTAAIATAAAGPCASGVAAVTPPIGSSSPSTPAVQ
                     PLSDLPKSAGHAPVDLLKADVFALGVTVYTMLLGQLPWRASSAVSQRSAILAEPDPFL
                     RLYKSAYGDAYAWPPQVREACMPRRDVFGSVALPASSNAGASASGKDGCSASDGTPNA
                     ELSDVPRAIAAKKDGVGAPAPATALPCKRRHWSNTGTSLYECTSEQEKCTPTTAKLAA
                     APQPHRKAPTRSDHNSAQPIVERSTASAALPRPATELLAKNATTSESRAPNDLAEPLS
                     DDDDSRAAFEAPPPPMPPQGEQHLHLPQWGPFTDVVLGSVPLNVATAAGTAIAQQAQA
                     TVRYRHGDVGELVDGDLRHMNTTTACVRSRAPAVKMLRSRAATRPRFGSVVQAPHSLS
                     ICGEQRAAMSIPAGAPPLRPRGPTTTPDQLNPYRGILDVDDDDGINADESDVVQGRKE
                     SAIAAGQWVRGSSSNLLRTVPSSAVTDTRSNDSEADNASDDDSGRTTVPCSAATSTAS
                     SLDTDDDEDLESCESIYERLFEMEQPCRAYTVAEHMPLPVMPGTSREISGEAVDFVRS
                     CLCLDPAERRTVFELFRHPWIRGGEGATLVEADTSAGSQRCSPPAAEKGADVELSSGS
                     "
     gene            <257800..>260091
                     /locus_tag="LMJF_19_0600"
                     /db_xref="GeneID:5651159"
     mRNA            <257800..>260091
                     /locus_tag="LMJF_19_0600"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682585.1"
                     /db_xref="GeneID:5651159"
     CDS             257800..260091
                     /locus_tag="LMJF_19_0600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682637.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651159"
                     /db_xref="UniProtKB/TrEMBL:Q4QDG1"
                     /translation="MYPRARGKGGTQGAGHGDGDAVPGAARTMAAPLACDAASSSTTT
                     VGHREPVHSLSSSTASHHPSAGSGNRKSVHASQQQQSPPPMPHIQSGIYGEAMQDAGA
                     SSPTAPPPPHFYAGNVHHHGGSLGGSAHRSTTSSSYDQQKQPLPRPSPLHMNGHQGDW
                     LAGASSSPTMSAVVQRGFPAGMTTASATGQVSFSPHSRTNSSAVVTPSIGIAATSSSM
                     PAPTMSGAAPGSADYRPPAVYGEVNLGSSIGAGASVTHSSSLTSLNRTNASLSGSLVN
                     TVNATRRSPRMAASMAGASVGINTPVGAAAPPPPSNMGAGAPIVQVGMTGSSCPAAAP
                     VRADVPGVTSLKITVGGCTSVIAASAPLSPLMNSPLLARQQPHSQARQPRSAERSKRP
                     LHATSDARKGGVDNIDVESDEDRSRSPGMGPTKPTVEQAEARYRYLHDEFRKVSRLRA
                     KLVEENECMKREQTALREALDLYRRKIVSAAAERKTLLADYLEDVHNALRLAQELAAD
                     VAAVHSSGDGASRPALASNGGVHSIPVASAQQTLDAAISRVLASNASIAAAAPPTVPP
                     SGIPVPLAPPQGAAGFSGSPLLSIGEQLGLRYGRWMVMRAAAPCFPMMGEEASYPDLS
                     EGHRRSTGPWCQQGVLLRDEIRDVYCNTHAAISAYMTSLDYGFAPMFSQGSYPPAGCQ
                     GQCHLQQQLSSEYHGLRFHVDIPRFHAHTVSSVSDAANAGGDCTGGQNTPVHSASSQP
                     PLLQEPPSPYLAPQNPRMTPALT"
     gene            <264964..>265245
                     /locus_tag="LMJF_19_0610"
                     /db_xref="GeneID:5651160"
     mRNA            <264964..>265245
                     /locus_tag="LMJF_19_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682586.1"
                     /db_xref="GeneID:5651160"
     CDS             264964..265245
                     /locus_tag="LMJF_19_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682638.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651160"
                     /db_xref="UniProtKB/TrEMBL:Q4QDG0"
                     /translation="MSAMALLQMWTLVAVVLSITVAQVVSAASKTYVAPHPTVGLSSK
                     DEEYLIGVVSFAVVVAACFMGIASMVKIDYDDDTLLMVEVPGDIHHEKE"
     gene            <266634..>268871
                     /locus_tag="LMJF_19_0620"
                     /db_xref="GeneID:5651161"
     mRNA            <266634..>268871
                     /locus_tag="LMJF_19_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682587.1"
                     /db_xref="GeneID:5651161"
     CDS             266634..268871
                     /locus_tag="LMJF_19_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682639.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651161"
                     /db_xref="InterPro:IPR023577"
                     /db_xref="UniProtKB/TrEMBL:Q4QDF9"
                     /translation="MQIEVKLSLEDAESYQRTLNTLANHHLKDECYYDFFFDFPYPAL
                     QERSSVLRLRVPCDPASVYARSAASAPSASAGGNGNYDPEAEYEALLRACRGEAPPGI
                     GVAAGSSTSSCVHTAAAIPKTGGGGRSDHGLPLPIFIPGTAGKLILKQKNMVEHGHQM
                     SFVVEDAQVPAAVVEALVRLVPDSLFTTGAVPASTATDGGASNIFAVLSAYAQQRPCS
                     EDGSGESAIVRILYQLSAIARVYAPSNDAGASAADPDSSDAHFAQVRFAAMGSHTAYA
                     KQQLATSQRTLSKEGGKLENGGGASAVAVVPQLEAVAGFMTLRKVFSYAPLIALQQGL
                     VTALELTESEREFREGLRVRVDASYLLPGLTIYELEVPKCGVAVDDVATEVGNFLRQL
                     AVSFHMGSESKFARYTQYLAATREAERDASDVKLRLTSVNGYEEVRRNLQQLLLPTSA
                     AAAQSSQDRRHLSNTEVNPVEGEEAGADDTWWHTNPNGYLQETNEDLFFDSPEQTLRR
                     GKSFLRLRKRLHSNKYLLALKAHQVFSGGQQNSLSSKVDVSEVVARALIDNPTQFLHE
                     YAEHFAVVKTVWKEFGVRELCRTATFTTERLTVPWWAAQVQQSTLQRSWAAGTASALA
                     QQSQPIYTSTSYYLSQQQQQQQRGYGTESKLPPVPPLIIHLDRTLYKLPADAQAPRIP
                     FTQCRSWGDRQCETYEIEVTNIVAPTEPKDVVAELTTVLNGLGVEWSVGVRSKLEQYF
                     SLMDM"
     gene            <270430..>270864
                     /locus_tag="LMJF_19_0630"
                     /db_xref="GeneID:5651162"
     mRNA            <270430..>270864
                     /locus_tag="LMJF_19_0630"
                     /product="putative histone H3 variant"
                     /transcript_id="XM_001682588.1"
                     /db_xref="GeneID:5651162"
     CDS             270430..270864
                     /locus_tag="LMJF_19_0630"
                     /codon_start=1
                     /product="putative histone H3 variant"
                     /protein_id="XP_001682640.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651162"
                     /db_xref="GOA:Q4QDF8"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QDF8"
                     /translation="MAGITKAAVVASHPKKNVASRKMNKKSRSIAKKEAKAMRADSAG
                     AKSRRWRPGTVALREVRKYQRSTELLIARTPFRRLVKEIMSTFKDTMHMRHSALEAMQ
                     DATESYLVSLLCDANLCTIHAKRVTLYPKDLQLALRLRGERT"
     gene            <273215..>275803
                     /locus_tag="LMJF_19_0640"
                     /db_xref="GeneID:5651163"
     mRNA            <273215..>275803
                     /locus_tag="LMJF_19_0640"
                     /product="putative extracellular receptor"
                     /transcript_id="XM_001682589.1"
                     /db_xref="GeneID:5651163"
     CDS             273215..275803
                     /locus_tag="LMJF_19_0640"
                     /codon_start=1
                     /product="putative extracellular receptor"
                     /protein_id="XP_001682641.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651163"
                     /db_xref="GOA:Q4QDF7"
                     /db_xref="InterPro:IPR001828"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="UniProtKB/TrEMBL:Q4QDF7"
                     /translation="MTEASLSEAITAFLTNTSATHQYLITLFRPAPIILDTGGNLLTA
                     LTQITVLLSNPLTFPSVLFLAETADVSASVVDMLRQNDTTSEILIISAHSSNTRLCDP
                     KTNRRTMCMVPRDMINVRGLLEVVSNQLSWYSMSLALSNDNYGDGVAQAITSEVQTAS
                     TTATIVAHAFMNGAASTTDDDAVVASLIKYRARGVGCFLREAETRRLHAAVERNRRAA
                     NSVFLIASRESLNVLPDLTGDMNGTAKPWGAIFVSAYTPPAELVSQGFFPTTHGTAVD
                     EYGAFVLSHLLDGLLMLDAAKGAIDNMSALRAVRFRGYTGNVAFDPIYYQRVETVFSL
                     ITASHTMRNPLVTWTLKDYSSDAAQVNANPNVTSALIKTSPLRTATICMASPSNCAFT
                     QMMMSMLFVITAHNENVADNDSDSVFNFYPVAVNTGASGVMGLSSLIPIARSCTVLTG
                     PGSDAVVMAVTPVVNEFHIPQLDYAVSNDYFTDNVHTYPYFSRSLPKNTFADVAVTQL
                     CVHYGWERVIIITSNDQFGISRAQSMATRMQQQNLYVEATYYLSDGNNATVADCMEKI
                     YAKLVSRIIILINPFTATQAETFFRLSDYLTYMRQYIFFMDSALCHAAAASANGDALR
                     QKLPSSICIYPNVTQTRLAALNTLYTNSDYATTRQEMRKLMSDGGFLSSVESCDISSI
                     SPYAGFAVDAGYVLIDSISRAVAENVSLNVAAHLLPYIRSTSIDDFTGECTIDSTGNR
                     LYAAYSINIQLLNGSALFIGTWNSKASPALEITEWSFVWLTNSTAVPLDTFRDASFVL
                     STAFSASPGAIVISVLGFILTIAVFYFCYRHYRMQKLIEQALEANQFPVTDEELRSLR
                     GIKDDV"
     gene            <277193..>283003
                     /locus_tag="LMJF_19_0650"
                     /db_xref="GeneID:5651164"
     mRNA            <277193..>283003
                     /locus_tag="LMJF_19_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682590.1"
                     /db_xref="GeneID:5651164"
     CDS             277193..283003
                     /locus_tag="LMJF_19_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682642.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651164"
                     /db_xref="GOA:Q4QDF6"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QDF6"
                     /translation="MSCSLSTFPTTRQACPIAPVSALRAAVERLQQPDATAAGGVDTR
                     RPNYLLDVPVSAIDVDRWEKRLQEAMSAVSSSLPSLGVGTKRQLHFQHASMAYAALMT
                     ADEASAPTNAPSSRHLAPLPPFMFATVKALPMTQLLKMRRQWLPHRQRFAVHQQRMGF
                     LDAVLSHALVALVGPAGSGRTLQVPIVLSETEVLKRRRLIVVSANAAAARLTTLRLRE
                     ERGEDVQHSRTVAAAVPNHNETTESTSVVVTTAEVMLRQLLCDPCLEDVGCVVFDDAH
                     LRNESTELCLSLLRDLLAVQQQWEHQRGAPAGSAVASSSNGPAAGTDADTAQGLDAAR
                     RRRLHIVLNCPDEACATTLLSFLAPSRCTATTFVLQTAPTLMTANTTLYLEEAVQWLL
                     KTEKEGSCLISDSAAMEATLVSYAENVDAVARIMAAGDADFAHPAAFRRYWLPLIQQC
                     VDEFDKADRDVAGATAAQGRSPLSAIVLVAPNNHYVHVIANAVREAQRTSTEGDAAAW
                     RVCTALAEDSPFSSFLTVAQRTAVRDTCQRWIIVATSELSQSVLPSGLDVGLVVDCAR
                     NGYTTVDTTTMADTVVIEYSTIAQLRHRRKLAKVTATASPAAGGDGSTPASPVVIQLI
                     PKSILHGAHHRRLSADPAQHIIFRLPFSRYVQVYQVLQAREEAALSQRAAFSLSAAGS
                     ANSSSAVGGGPSIASKVSTVLASQLIGVPAATATRYEAVRRIMASVESYLRAAGHLAL
                     DNTAGSPAMGQLVLQPMAVLSLCLPVPLQVGRLLIVGSLLRSSLAVVTAVGALWCCSD
                     LLSLRGAGAVRVADASDAAREAAEEQAALLTEARLFFSRDSLSDVVSALHVYQMWCST
                     KAKPEAERDFLAECGVAGEVLQAVFDTQVQLCMLMRTYGLLLQPGERGESRRAGAGES
                     EAERALRVCVESVQQSTSESVEQVSSALGRAMAALLPEVATSRALHACVTAALYPSCV
                     VPTGEEGISLVYDGVSTSSSGGAGGGGESSGSGSPAAGAGRRVASFSSDCVLADAVQC
                     AKAAGRPFLFLAKSIADVATREAAVIGASSTVAATVVEQVDPLHEAAAVVFCGHCHER
                     PRKAPTRCRGWSSVLTSRWRETRRARALPPVSQLPPTCISVQSYDTVHCNHVVCTMDQ
                     NLSLTMRSTTAKWLQQLRTHVGAYLAALACGVATSNSNGSLKEASSTLAAELAEAWEW
                     WERRHEQGRDWLREERVVVAHQQQQMEAAAAAGYDEQEQAASAAKVAALRQRLFGYYE
                     WKIRPGTPAAVVVPSNAERQAFAKSAAAAAAAATKGSGEVDNGDVGAAAEDDDATAEG
                     AGGMQATYSGKVPPADIDHIFRLCVKSVAAKGTREAEAQLLRDNPDMFGFLNPEDEFH
                     EYYLYLLRQAAPDMEVLGDNLEELIAFLEDLEAELREELGLPHPNAAVQEDAGGVPGR
                     HGNGEDGAYGASAAGIWGGDGSGDANGQWSSGPFGGGYAVHDVPVGEGDVDGYGDGDS
                     GGLQLESAAINLKKSAGPTLAEKIEEAKRAQANAASTTGKSAAVAPSVMIGTPAAPVQ
                     MSVPAVPSPASGNTPFVSTNAGETLADKLRAMQMAAMGGSAGNASDLAPLQFSAHPSA
                     DPTSVLPEPAAPCGVLPPPPTAADLLAVINGGDSADVAPPQASLDLDFQQAPPTAEEL
                     LDLLGPALPTAAPDGPFPAGSSLGGTRGSAPLPSAAMAAMMMGMPATPLHRPPPAIPA
                     KAVEERPPSVLVYPVPDIRKYGNVRLLLAKSLSESLNMRVGPTTIVGHVARIDVPNRN
                     VEARALALKKFTCGDTKVTVHLFKNDRIIDDPEREERERRKRREELRQQEAELHLERR
                     RRTGAAAGGDTPARAKASRRAGNVGAALTGSAGIDPTSPDAFNDPSAYTADAAVLSTK
                     IGVGKAAPMRIGVLSSSEDDDDASSSADSSSSSSSE"
     gene            <284098..>285426
                     /locus_tag="LMJF_19_0660"
                     /db_xref="GeneID:5651165"
     mRNA            <284098..>285426
                     /locus_tag="LMJF_19_0660"
                     /product="putative DNA-directed RNA polymerase,alpha
                     subunit"
                     /transcript_id="XM_001682591.1"
                     /db_xref="GeneID:5651165"
     CDS             284098..285426
                     /locus_tag="LMJF_19_0660"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /product="putative DNA-directed RNA polymerase,alpha
                     subunit"
                     /protein_id="XP_001682643.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651165"
                     /db_xref="GOA:Q4QDF5"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="InterPro:IPR011262"
                     /db_xref="InterPro:IPR011263"
                     /db_xref="UniProtKB/TrEMBL:Q4QDF5"
                     /translation="MSKSRRDVNKVQIGYHRAENTETVSSPHTYAYSSGKSAPSTTKP
                     DRPTVSNIRIASAVAGLPPSRFAANASVKREKNDEESESPTAAASSVSSSLLHGAASE
                     ARTTVDGFPWSTRRVERMSFEMQNVSPPIANLLRRVLTTEVPTLAFDRVLIEENDSPV
                     LDELLSHRLGLVPVAGPVMKMHYITESNQASFSNLDPSRVLLFELDATGAKDAAVTPV
                     YSGQLQWVPLPGQDKTAGAVAVACQAGREECAGAAGATDHSADEDDDAVFLVHPDILL
                     TKLGPGQRIKLKAIAVKGFGAVHAKWSPVSACYYEMKTSVELCERLTGSAAEALIKSC
                     PAGVFGYEGGQRGAAATVVAPEKCTLCRECLRSEDKGAEAAANKGDRVRVQKDKTHVL
                     FHIESVGQLHPAQILRFGLRLFAERCRALAEMVQSTEVHVVDASAKSLEL"
     gene            <286457..>287542
                     /locus_tag="LMJF_19_0670"
                     /db_xref="GeneID:5651166"
     mRNA            <286457..>287542
                     /locus_tag="LMJF_19_0670"
                     /product="putative U3 snoRNA-associated protein UTP11"
                     /transcript_id="XM_001682592.1"
                     /db_xref="GeneID:5651166"
     CDS             286457..287542
                     /locus_tag="LMJF_19_0670"
                     /codon_start=1
                     /product="putative U3 snoRNA-associated protein UTP11"
                     /protein_id="XP_001682644.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651166"
                     /db_xref="GOA:Q9U178"
                     /db_xref="InterPro:IPR007144"
                     /translation="MTKGKGRNPGASGLDKHLKRKTHLERSQPKSRQHLGQLEKHKDH
                     VLRAKKRKVKVRRLQEIKRAAAQRNPDEFNIGMTKAVMDVANGRMRQRRVRLVESDRK
                     KDMQTTIEHNRRNVQYLEFKAQADQQRATELLNEEAAAALTSTAPQNKHIVFVNSEEE
                     FRSFNPLKHFDVTPEMMRQHPAVRGRIRVLEKTVMPEEILMSGGHQIKSAAQKRKERR
                     EVQEKMRRSGADATPETRAAFVERLRAKKELKQYQFTDLLEEVKRESEATASSSKGAP
                     GDDGEQEEAAAQDEVTRLLEWRREQERQAAIATARHVREVGQRIQRSKSLSALAKSIR
                     KQSQGIKRQMEQRRESRFKPGATRRAR"
     gene            <289446..>292631
                     /locus_tag="LMJF_19_0680"
                     /db_xref="GeneID:5651167"
     mRNA            <289446..>292631
                     /locus_tag="LMJF_19_0680"
                     /product="putative kinesin"
                     /transcript_id="XM_001682593.1"
                     /db_xref="GeneID:5651167"
     CDS             289446..292631
                     /locus_tag="LMJF_19_0680"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001682645.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651167"
                     /db_xref="GOA:Q4QDF3"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QDF3"
                     /translation="MSEYPMPITQTQSNAMKVYIRVRPFSEREIAQKVAPHSTVRIDA
                     QNPTQLTILDPSRGFRPLTTHPFTRCFWSVFEKGNGDLLNKVDTYLTGGMNSARRSRA
                     QSLVTGQPVMNSVRRGTRTGLDSDATSSTGAAYDGAGSAPVMVDANVSHPPYAGQDQV
                     YMHVGKPIVGNTLDGYNGCVFAYGQTGSGKTFTMLGYAPSTSDIRARKGSVPCGVSSM
                     ENSTPLDSAVEPFESDDGDDVVDKTGLDPNELQGIIPRACTDLFDGLRAKRAKDSDFT
                     YRVEVSYYEIYNEKVFDLIRPQRNTDLRIRNSPNSGPFIEGLTWKMVSKEEDVGRVIR
                     KGMQERHTAATKFNDRSSRSHAILTFNIVQLSMDDSDNAFQMRSKLNLVDLAGSERTG
                     AAGAEGNEFHDGVKINQSLTVLGRVIDRLADLSQNKGGGFSIPYRESNLTWVLSDSIG
                     GNSQTSMVATVSPHSINYEEMRQTIMYACRAQQVLNKARRNVDPTIMELRELRAQVVD
                     LRLRLKEAGGSNYTNEYVRGLEKRVKELEWQCADQERIVSQLRAELESAGIADPTLIL
                     KPSARGGAGAAGAGGGSANGGDVQGGVSAATYRRTNEQLQSELTSANKEIVLLQTKLL
                     ESAKAKSGKLDGDTESTIAKLQAKCDLYRNSFREWEAHLNQYNTYQWRWSTDYIFGTF
                     EDKMNLLMRQCQNLMMDKDACVMDALNRGESAQLRETAKIQREHLAEVSALTAQYRES
                     IEKLKKEYAERDEERLKRQKEVSNSSELRMQATRETFEQEKRRWVQERDNMKLGYEEK
                     LAALRAEYQGDLKRLRELLASTTGDRQRQGGALQELQERHESEMKSIGQDMERERKRR
                     EAELEMVKKQMSTELARKEEQIAARDAQARRTEEEATKLRRDNLKLQTDMRTKERQLN
                     TEIKDLLLKQENMIAVLTTIVGNYEKNPTSLTKDIEALRAFVSDKDYAAFRAKAKEGA
                     FRDPASRRASAVMRSPSSVDEQRSREVEDIRNAIESMRKTRSDQQANLQQVQQHVYAQ
                     LSRSRGFQSSGEVDERSHDGNAPAQNGNTAA"
     gene            <298713..>301817
                     /locus_tag="LMJF_19_0690"
                     /db_xref="GeneID:5651168"
     mRNA            <298713..>301817
                     /locus_tag="LMJF_19_0690"
                     /product="putative kinesin"
                     /transcript_id="XM_001682594.1"
                     /db_xref="GeneID:5651168"
     CDS             298713..301817
                     /locus_tag="LMJF_19_0690"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001682646.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651168"
                     /db_xref="GOA:Q4QDF2"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QDF2"
                     /translation="MRSEFYESPATTKANAMKVYIRVRPFSEREIAQKVAPHSTVRID
                     AENPSVITILEPARGFRPLSTHIFNRCFWSVFENAKDGTESEQSDIRNGVDTFLNGGM
                     NSARRSRAQSLVTGQPVMNSVRRGTGAGLEPEGMETVGEAAAYDGAGSAPVMVDANVS
                     HPPYAGQDQVYMHVGKPIVGNTLDGYNGCVFAYGQTGSGKTFTMLGYAPSTSDIRARK
                     GSVPCGVSSMENSTPLDSAVEPFESDDGDDVVDKTGLDPNELQGIIPRACTDLFDGLR
                     AKRAKDSDFTYRVEVSYYEIYNEKVFDLIRPQRNTDLRIRNSPNSGPFIEGLTWKMVS
                     KEEDVGRVIRKGMQERHTAATKFNDRSSRSHAILTFNIVQLSMDDSDNAFQMRSKLNL
                     VDLAGSERTGAAGAEGNEFHDGVKINQSLTVLGRVIDRLADLSQNKGGGFSIPYRESN
                     LTWVLSDSIGGNSQTSMVATVSPHSINYEEMRQTIRYASRAKNIINWVKKNEDPQVVL
                     IRELREQVVDLEQRLKEAGGSNYTNEYVQGLERKLHQLEKKCADQERIIAGLRAQLEY
                     AGIVDPTVAEGYLDPATRAKEEQQRTKAEESMRKQLDKAQITIAKLRAELEHRGVTIE
                     PESLKAMKEKLEKQDAQLRALTTEVSLHRRLRSRFDNIDTIMELVKDKETLLLRACNG
                     ILIANSESAAILEKMLSEREDGLRDTKRLHEEELATQAERFCERLKEALDKGAVQQQQ
                     LLDRHRDAVAQLEGRLQRSHEISEMERRRNDKEKEEFRQRVQLAQERMRDEYQQEIER
                     LRARLEGDIGDRHKSRDAVRQLQEMHEREMERLKDEMNLLKRSKDSDCARLQNQLENE
                     RLRRESDLMEKDRQMRLLRNEVHDAKRTIEKLSDEKNSMEKEYQGQIRDLMLQQEQLL
                     NVSNAVLSGWENKSSALEADLHKMRALVYDKDYMNFRQNIRGLAFMERVDFDEKLKEL
                     DEKERLQEARIRQIISKARRAYDEQNRSLKRFEQDIKDRIGRAKAGDGSSDTSLRPED
                     LPSP"
     gene            <305976..>312641
                     /locus_tag="LMJF_19_0700"
                     /db_xref="GeneID:5651169"
     mRNA            <305976..>312641
                     /locus_tag="LMJF_19_0700"
                     /product="putative kinesin"
                     /transcript_id="XM_001682595.1"
                     /db_xref="GeneID:5651169"
     CDS             305976..312641
                     /locus_tag="LMJF_19_0700"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001682647.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651169"
                     /db_xref="GOA:Q4QDF1"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QDF1"
                     /translation="MAILTVSDEHPSHITTLDPSKGYQPKATYVFDRCFNSATACVTE
                     EAQRLLLGNGKDVGTAPTAFTALEEASAEGSINPILLECLKRDQAAVYGHVGRPVLLN
                     ALAGYNGCVFAYGQTGSGKTYTMMGPPGVFGATVSGAPGQVRAVTPAKKFRRAATAYN
                     GQLRWTPEASADDVMDSRFQSFVSVTPRAHVRTPCSGGHRDTMSMVGEAPLPMDCSLS
                     VSSDVLLQRSRRGSRCDSNVLYLGEEEGLQGIVPRLVRELFAELHQKREQDNSHSFRV
                     EVEYYEIYREKVIDLLSSSAAAAAGVSGSGSVELRVRHSKSAGPYVENLTKKHVDDEG
                     EVFRLLRHGNLRRHTASTAINDRSSRSHAIFVLHLVQMRISNDDSASAKVSSKVNLVD
                     LAGSERTGAHSVEGDQFKEGVVINSSLTVLGRVIDALADKSSGKRNVFCPYRDSVLTW
                     LLMDSLGGNSKTTMVATVSPHSSNFDEACQTLRYASRAKQIVTKVVVNEDPQVQQIKL
                     LTAEVQRLKARLSAEGKAADNDDDVEVLQERIAALEEELNETRNQLEQKSSELAAICA
                     SRHTSSMLPSTLKAGNAGAAGTAKELAKAKSDVRRLEAENLLHLQTEQELRGTMERLK
                     TLERKYGQLLSESKEVQGTAKKRDREMQEKDRRISELQHQLQQQAARMQADSSLASNL
                     SALSPRSVWGKSGETESAATTTGVAPMTPIMNANESGKAAGKKTRKAKTGTAPPGSPQ
                     RRDSERLDEISRIRVQFEKDKKQLVSQIQERNNAFRKSQLEVKQLKSELKSEQDALRT
                     VEKSLHDQHVETTRRLQEEVQELKRALKGECRNNKYLRQSLTAPEEAQPPFLYAYVAQ
                     TVYDEEKWRGDVQQQEASEWQHVMQVWQLSQVGAAKMAAVERQHASQIAALSEAHRTS
                     ENIVSAIRQELEEMRAVQDKANAMRERISELEDAATQQREREKHLREQVSDLEGQLYQ
                     EQERSKTALQRLEAELKDQRRAVATAEEAATSLKAAHAREKQQAESTMRAEQEQHATV
                     VASLQAQIRQAEDRLHSSEEARRAQVRRGLEQASEHEAVLAMLRSQLESSKKAAATAE
                     EVHRGERAALEQSLKQQEKAFASRVSVLEQELAAARMQLDRDSRTSAKALSELEEQLA
                     AAQAAHNASAEALRLNSERAMAQAADHEKAAQLLRRDLDTERAAAQTAAHEHAALAAT
                     LAEELQTQRKQREEISASLTQQLAGLQSKLAVAEEARRTERTRAADAAAAQETALADL
                     RAELESAQAAHTAAAKAHEEQLREMRGTHARLTQEVQSNADSLAAQVTKLQTRLAAVE
                     RDSENALGTLTKEMEAIRTQLHKSEEARRRQIQQSIERAGEHDAALAELRQQVAEEQA
                     AKAAAAKKHEEELLKAEEKLSAHRLETSETISTLKQQLEQAHHSAQQREADATALQQI
                     LQRALDCTRAELEASEKARTAHSQQSLEKAAAHEQTEAKLRAEISCLAARADATDAAH
                     STRVAELEERLREQQCAAAAQLAEAAAALESERAKAQHASEDHKKFLAAVLDKVALLQ
                     AALAKSEEAERAQVQRLVEQSAAHDSAIQAARRDLQRQQAEAADLAAAHAEELHGWEA
                     RWQQQAALNKVEMESIRQEVEAQRRAEVDAAVKAHTAAVDALEANLSEAHIRLSEVEA
                     SRAAEAERREQQASEHAKAVSALEAELQGAHQASAAAAAAHEAAIQQLNDVIAEQQRA
                     KIEEVATMKQKLLETQKKLTRSEEARRRGVTEKAEAATAHTQSLDALRRSMEAEHQQK
                     LDALTAAKARELEAVQMQLDEQRVTAQHLQGDLRKTRRQVKQLVETQNCLGKQVEEEK
                     QASAELRRNLADTAAQQAASAAAAAELETTLEQTKASLTQLVSEKTAVSRELAQAIET
                     VDSTRAHLADVEKISQQRHEELEAQGAALANAVATVEQLRAEVSALHSKCSEMEKART
                     ALIEQHEEALVAQQVDTVTEMETQFRAMECEREALVSKARQTEEALRSLVEKQGKQLQ
                     QLREDLEFRVSLDLCEAEVVERDSAAGAVGSSAGPALAGSGTGVATSNNTSFSGASGS
                     AAAVGGGGFSTILSSLFSRRNSTAAPSRSPAPLGSGIGIDGTHSLPQQLPRPFSNDRG
                     TATTPLRRTASGNLYSMSAYRPSSMMPSSLLFGKSNPAGAVAMGTSAGVSSASRTPVQ
                     DAVISPDTSEQESTLPTRLGSRAPNIALGRK"
     gene            <314147..>315115
                     /gene="gMDH"
                     /locus_tag="LMJF_19_0710"
                     /db_xref="GeneID:5651170"
     mRNA            <314147..>315115
                     /gene="gMDH"
                     /locus_tag="LMJF_19_0710"
                     /product="glycosomal malate dehydrogenase"
                     /transcript_id="XM_001682596.1"
                     /db_xref="GeneID:5651170"
     CDS             314147..315115
                     /gene="gMDH"
                     /locus_tag="LMJF_19_0710"
                     /EC_number="1.1.1.37"
                     /codon_start=1
                     /product="glycosomal malate dehydrogenase"
                     /protein_id="XP_001682648.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651170"
                     /db_xref="GOA:Q4QDF0"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:Q4QDF0"
                     /translation="MVNVCVVGAAGGIGQSLSLLLVRQLPYGSTLSLFDVVGAAGVAA
                     DLSHVDNAGVQVKFAEGKIGHKRDPALAELAKGVDVFVMVAGVPRKPGMTRDDLFKIN
                     AGIILDLVLTCASSSPKAVFCIVTNPVNSTVAIAAEALKSLGVYDRNRLLGVSLLDGL
                     RATCFINEARKPLVVSQVPVVGGHSDTTIVPLFYQLPGPLPEQATLDKIVKRVQVAGT
                     EVVKAKAGRGSATLSMAEAGARFALKVVEGLTGTGNPLVYAYVDTDGQHETTFLAIPV
                     VLGMNGIEKRLPIGPLHSTEETLLKAALPVIKKNIVKGSEFARSHL"
     gene            <316992..>317906
                     /locus_tag="LMJF_19_0720"
                     /db_xref="GeneID:5651171"
     mRNA            <316992..>317906
                     /locus_tag="LMJF_19_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682597.1"
                     /db_xref="GeneID:5651171"
     CDS             316992..317906
                     /locus_tag="LMJF_19_0720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682649.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651171"
                     /db_xref="UniProtKB/TrEMBL:Q4QDE9"
                     /translation="MEDAIDFIQSRPLIGYQMDGSHLNNVLVSLARQQQQLMDTQNRL
                     NDRLADIVDDVREIREHQKQLEYVIGELGGAEQLHQVRSRIANVERAVDGLASDVQDA
                     KGVANAAGRDADQAGRLADDANRVALSLRDTVGTLGGDMDRVAHQLEAHHKSISKALG
                     DLDKDRHDLEHQMHEAMREVLQRAERMERESGVAHLRQMLDELSDRTDENFRSVEESA
                     RAVDAELSRQGANQAALRTEISALDERARAALAALSSDIDNKHHMLLDAFRQYEAGWT
                     DLEEHMVRAGQMLASRKQRSPGSTSIRR"
     gene            <319883..>321040
                     /locus_tag="LMJF_19_0730"
                     /db_xref="GeneID:5651172"
     mRNA            <319883..>321040
                     /locus_tag="LMJF_19_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682598.1"
                     /db_xref="GeneID:5651172"
     CDS             319883..321040
                     /locus_tag="LMJF_19_0730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682650.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651172"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QDE8"
                     /translation="MPSPLVLTRAAPARGLNVKMFDRKVKGLQRSFVSSPACDLHKLC
                     AQQMLDRRTFVKRDTPVVLEVGAHTGWYLRHMIERKEFHGLKQYIQTDISEDRLNRNY
                     EEIKNIIPPEVEFVQICCDEEQPSPFGIPDKSVDMVVSCLSMHWVNDLETSMVNVRKV
                     LKRDGFFLNAMFGGNTLYELRGCFSMAQTETLGGVSPHVSPMIDGAGLSTLVLQAGFN
                     IPTIDLDRHLLLYETPFHLMEHLAVMGESACHYMRQPMKRDVLLCACAIYDTMYKQNG
                     LFPATFEVFHTIAWSPSPTQAKPLARGSGQIPLSSWNSKSRKQLQSVLDEYALNPNDE
                     VLQNKAEDIFKKLREESAELMAKKGLDSRGFERDRDEEARRLDEKPVPPFQ"
     gene            <323009..>324349
                     /locus_tag="LMJF_19_0740"
                     /db_xref="GeneID:5651173"
     mRNA            <323009..>324349
                     /locus_tag="LMJF_19_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682599.1"
                     /db_xref="GeneID:5651173"
     CDS             323009..324349
                     /locus_tag="LMJF_19_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682651.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651173"
                     /db_xref="GOA:Q4QDE7"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR021648"
                     /db_xref="UniProtKB/TrEMBL:Q4QDE7"
                     /translation="MDYWEWKTDGAGLEADEVCITVQHGVTLYDKNEKTQRQNGKLSL
                     TTHHLRYNDEADISTVLQLPLELVRRSGQAPSISSGFGPFSSAKIIVPLPKNAYVKLS
                     FRSGGVDNFYAALVGALKKKTWLQTKTEAAASGRGSSSGASPASTTPVPNSRPPPPVP
                     RGFGIAGVQQASLQSAAMSETLKDIDDVMNKASKLVNNIRRLRERSEAAAAAGSDAGS
                     ETAVERTTIESIESTLGLGAIVTRNHSNGSDSRFYRDLAVEMHTWMTHECNSKLFNDM
                     PVVPLIELFALYNKARGGDLVSPLDVLNACTYMAAKMSSSCYDLVTLPSGRKALVNRD
                     DSLLLAKLTTVLGPQLVNSKGSPVQDAWTKTSSQQQQRSGDASSLVRVSTTSDFPKAS
                     RDLKSVSDVSLAEKMQVATEVAADILTLLMLKGYLCCMDTGFDCYVYTWNIFVF"
     gene            <325226..>326794
                     /locus_tag="LMJF_19_0750"
                     /db_xref="GeneID:5651174"
     mRNA            <325226..>326794
                     /locus_tag="LMJF_19_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682600.1"
                     /db_xref="GeneID:5651174"
     CDS             325226..326794
                     /locus_tag="LMJF_19_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682652.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651174"
                     /db_xref="UniProtKB/TrEMBL:Q4QDE6"
                     /translation="MERVASVLSALKPTLEKHQLGSWKPAEVDRLCAMLREYGKQERR
                     DKCGTSCLDGAATALASLPSSSSVPPSLPSGGDDVEDENDADEEAFAGVVSEVDRCLS
                     LVRDFLKRRMPFGAVVEPTLPAGTAERQAPQSSSADIISCKRARSLSGEPSSSAPTSN
                     SVHSGAAVVEAPVYAVDAFLYAEGDIEKLVEAKKLAREYCCRCGSTDLGLVEFITHSF
                     SQDQLVYLSCFLLPHLLDVVVASHEASRPLSIVDVGSRLGIVLWACAFALQRGLLAPA
                     QAATTDAAADDAAPEVNLVGIELDATFVKISQDVARRFFAQRRRHAPKLVSVPQPAAA
                     NGVDAKLPDVSSSIQLLQSDCFEGAAASALSESSLVVMHNVFEYFCTTAVEHARCWLK
                     LRRLVHRSGQFLVCSPALEVTLGTFTDEVWLQAWQLENGNDARGASTPLAWLASYVEP
                     FDTADVASDFLTMRTLSCEGCDAGSDGDKHHEDHHGRSRDHHHHSSEDDEGDGEEASE
                     MAEQIQRIYVYCVK"
     gene            <328674..>330149
                     /locus_tag="LMJF_19_0760"
                     /db_xref="GeneID:5651175"
     mRNA            <328674..>330149
                     /locus_tag="LMJF_19_0760"
                     /product="putative transporter"
                     /transcript_id="XM_001682601.1"
                     /db_xref="GeneID:5651175"
     CDS             328674..330149
                     /locus_tag="LMJF_19_0760"
                     /codon_start=1
                     /product="putative transporter"
                     /protein_id="XP_001682653.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651175"
                     /db_xref="GOA:Q4QDE5"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:Q4QDE5"
                     /translation="MGDLYFGVMLITATTVGKIILCALAGMLVSRYFSNPKETLTGLN
                     YISARVFLPCLLFANLCVNVTWEQLSKFYWAPLFALLPMGIGFLCSMLVRTVLRREYH
                     FVVILASSFQNGLTFPVSVLLNLKGIEWFTEAAVVDAQSYIFLYNVVCSIGLWGIGDP
                     MIAHAKMKEVESEEVNDEELVARRRPYSMDGCVDGEAEGEEQAQSSPHTAAVAQQGHA
                     TANEQLGWYRPARASDQPIMLSPGSPAILLNDAMRITNSTVKSKDDRLKRLGRIVLTS
                     IQSPTVLSSIIALIISLTPPLQRLATGPFGEPFVGGMALIGKGAIPLHLVVLGSSVTV
                     SRPKADPTSSTKRARVTISSPTTSAPLPTDADGTVFDVPASQPGTEVNALLHWITSSV
                     QPQILFTCCAVVTQLVIIPCICFLALHILVKTGLMPNEKPFLLSMLVAVISPTAINST
                     LICTTRGYHVRDYSHMMFFMYLCSIITSSVWLLCILSYLSD"
     gene            <331105..>331812
                     /locus_tag="LMJF_19_0770"
                     /db_xref="GeneID:5651176"
     mRNA            <331105..>331812
                     /locus_tag="LMJF_19_0770"
                     /product="putative SNARE protein"
                     /transcript_id="XM_001682602.1"
                     /db_xref="GeneID:5651176"
     CDS             331105..331812
                     /locus_tag="LMJF_19_0770"
                     /codon_start=1
                     /product="putative SNARE protein"
                     /protein_id="XP_001682654.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651176"
                     /db_xref="UniProtKB/TrEMBL:Q4QDE4"
                     /translation="MTAVVDASGTVEGELRQAKDTLKTLSALAEQAERGAMVDYDLAQ
                     RLMHEVSDRVRPLAQGTMNSFAGTTVVSSSGATLHARAGAGCSQNVTPLQRRRAEQVL
                     SEVKLIEATLHRYAKKAEQQATYVSDLKSLVGNGTGAYRQNYEAMDHLEREKKSLQYA
                     RQRMQAMESESRDVLAALQDQGRRLGGVGNKLGNLLETLGVSNMTILQIVRRNKADAW
                     LVYGGIALLLFFLWYMW"
     gene            <332513..>333271
                     /locus_tag="LMJF_19_0780"
                     /db_xref="GeneID:5651177"
     mRNA            <332513..>333271
                     /locus_tag="LMJF_19_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682603.1"
                     /db_xref="GeneID:5651177"
     CDS             332513..333271
                     /locus_tag="LMJF_19_0780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682655.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651177"
                     /db_xref="UniProtKB/TrEMBL:Q4QDE3"
                     /translation="MELGQTQRPRAPVEPFQDYEPRRKCTVCCGLRCAAFAGSATFCV
                     SLVCNAVVLGGRVTDGRGWRGFLNRNALIALPTAAITFTHQALLSESLWSKNKKTVTQ
                     VNTLSALSNMSLWVVGTVLCTTMSRRYLPARSRAYRLALWEYHRARRGCANPWMPTIF
                     GRVMEDLDWYNVMWTLTLYHLLWGMVSVMLEKELGSHYAMFYRNWQYSRWCSPRWREW
                     RELEVRRHVDTEQAVAPNRWGTFITNDKWRTRHF"
     gene            <334074..>336296
                     /locus_tag="LMJF_19_0790"
                     /db_xref="GeneID:5651178"
     mRNA            <334074..>336296
                     /locus_tag="LMJF_19_0790"
                     /product="putative signal recognition particle protein"
                     /transcript_id="XM_001682604.1"
                     /db_xref="GeneID:5651178"
     CDS             334074..336296
                     /locus_tag="LMJF_19_0790"
                     /codon_start=1
                     /product="putative signal recognition particle protein"
                     /protein_id="XP_001682656.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651178"
                     /db_xref="GOA:Q4QDE2"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013699"
                     /db_xref="InterPro:IPR026270"
                     /db_xref="UniProtKB/TrEMBL:Q4QDE2"
                     /translation="MSEVLKLEKTLRKQATSDDLQASKIASTAERILSLQPNHVYAMQ
                     CKSVALLHSGRFAAALSVLENLQLETTPFKNSATFHLHKAYCHYRLMQYTEARAELHE
                     QQQRGPMSTAARHLLAQIHYNLEEYAEAAAMYAALVADGAYRDDVEKQELLTNYTASL
                     SACAPEKVAAVVRDEADEKTPDLLFNLATAQVEAQNYEAAQATLLQAEQLCAAIFPKS
                     TLRSLKDALAAGSEVLQAQLGVPLGAPTSIGGSSSIATSPERCFFNEVCSNWVQQAYV
                     AFMRHREDDARRIIDLILTYKPSSSVTSAVAGILHTALQRSADFFDSHRKLKAAQHVK
                     VLSRLTSRQRIAVQYNTALLQLSAGALDRCARTVEQMEKAHPNSELTHSLRLVLAVRE
                     LKKKKSLPATSPSSASRPARTATDSARDMQECVRNYEAEATRHQGAGSSEAENRKRHR
                     FLQLITAQLFLEQGDLAHAVETLQALDDFAVARRPTTVMTMAAWEAQIGDVDAAMALL
                     RERLTATTCGYSVAVKKAVLLWAVQDLAMARGLYAAVGQLLKAVQAADASLRKDREVT
                     ALLVICLAETDLAEAKRVIGTLDADAAAALSGSGSSSRTAPSEKQIEALVRGNPGAAA
                     MSELGYRRVTAVDQEGAAAGGRAASGAGLPPRRRRPMRRPAKNMDGKPDPERWIPMSL
                     RSYIKDLPERRKRELRRLRAFDQEQKRRAAAVARQKQKKDEQLQRQQVAEASPVTSAA
                     "
     gene            <336892..>338730
                     /gene="ABCF2"
                     /locus_tag="LMJF_19_0800"
                     /db_xref="GeneID:5651179"
     mRNA            <336892..>338730
                     /gene="ABCF2"
                     /locus_tag="LMJF_19_0800"
                     /product="putative ATP-binding cassette protein subfamily
                     F,member 2"
                     /transcript_id="XM_001682605.1"
                     /db_xref="GeneID:5651179"
     CDS             336892..338730
                     /gene="ABCF2"
                     /locus_tag="LMJF_19_0800"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     F,member 2"
                     /protein_id="XP_001682657.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651179"
                     /db_xref="GOA:Q4QDE1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QDE1"
                     /translation="MGKPKYLKKKQAAAAAGSEDGADKDVSDNTENTNGSPTTTNALG
                     KQSEAAKEEPHSSGAMVSFANPVYRQGVNDILVEKLDISYQGNAILENATLNLVSGHR
                     YGLVGPNGCGKSTLLRVLGCHEIPFPSHVDRYYVSQEVEASDMSALDAVLAVDKEREK
                     LESEMEDLALGDQEDPHVLSRLDDIYKRLDELDADTAAARAGKILFGLGFTKEMQRRP
                     TKAFSGGWRMRISLAQALFINPTVLLLDEPTNHLDIEAVVWLENYLSKFKKTLFMVSH
                     SQDFMNNVCTDICHMHLKKLNCYDGNYDQYCITREEKESNQMKKYQWEQNQIKNMKEY
                     IARFGHGSAKLARQAQSKEKTLAKMTRGGLTDAVVKDSRINFEFPCAGPLPPPMLQFR
                     EVSFNYPGRPSLFTNLDLGVNMDSRICLVGPNGAGKTTLTKLMCRELEPTAGYVAKNA
                     HCVMARFHQHFVDQINMDLTPLEWMSQEYPDVTQPPILRSALGRFGVSGKAQMTPMKT
                     LSDGQKSRVVFAWMAYKRPHFMILDEPTNHLDIESIDALADAINNFEGAVVVVSHDLR
                     LLAQVADEIWIVEQGEAKRFNGDIADYKEHVQNEVNRMMQNYAASL"
     gene            <341537..>344146
                     /locus_tag="LMJF_19_0810"
                     /db_xref="GeneID:5651180"
     mRNA            <341537..>344146
                     /locus_tag="LMJF_19_0810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682606.1"
                     /db_xref="GeneID:5651180"
     CDS             341537..344146
                     /locus_tag="LMJF_19_0810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682658.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651180"
                     /db_xref="InterPro:IPR007234"
                     /db_xref="UniProtKB/TrEMBL:Q4QDE0"
                     /translation="MPVRYSEAVERAMAEVCPPRDALDAANFDPVVYLNSRFPDEASL
                     GALPAFLDEANERLRKTENQLLKAVEQQASNATSAESDLKGAKEAVAQLYVRVSEIKT
                     QASDSEEIVKDLCQNIRELDVAKTNLTSSINTLRSVQLWMLQLQVLSSSFEKRRFSQA
                     RDALQEALKYSAMFAEMKGIPKVKELNDKQTQLCRQAEYYIRNTVFGEVNLEAMDESL
                     MAEACAVVDLMEEESKKKLRDRFIDKLLECYSLRFKRGTDEAKLERTERRYVFLRGLL
                     ERYDSVLKNVFPRHWCVPQELCVTFCLHTKQELDYALREAANKIDVVVLTYVIQKTID
                     IERDLTQMMTWKDEFAAKRDLPVYKYNGMILSAFKAHMGLLVQNEDRLMREALAQPLI
                     GSGDSLCPGWNSIDEETRSGTYLPIAEDIFVFIKESLKRALRIAQQDVLLEMAEVWRR
                     HLMELAQALSALLPDPAASPLERRRACIILNTADLCQSTSQDLGDEVCARSEAPPREV
                     AFDQVSEAFSAVYTKSIQSILQGLELQLAPMLVGYGNGGFLPKKGTVAYDANGGGAAD
                     ESKVVRDITTTVHDAFVSCAAVMPPTALRFLLDKMAATFIPEYGNTLYRLRRLPDDGI
                     NCMRVDAAALEKTFLQLPNYNDPARFPAPALTGYVRLVRKEFDQLNRALKVLQVDART
                     DAFIEVYYEVVLPENRSIHNFVRLVELKGLRREDVRAWVATLSKRGVVEATKRDLQRE
                     ASLGLSTGVSSGAAGGGASIASGVGLNFASLFTRDASTSLAPPRLPNASSTVSPTTGG
                     HFSLTNLVSTIGGGGMNGAAASSEGAGETAAVAEDGAAEEERLGSIFATMARSTATSM
                     NFLNKLKRGEGKQ"
     gene            <345240..>345605
                     /gene="ATG8B.1"
                     /locus_tag="LMJF_19_0820"
                     /db_xref="GeneID:5651181"
     mRNA            <345240..>345605
                     /gene="ATG8B.1"
                     /locus_tag="LMJF_19_0820"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001682607.1"
                     /db_xref="GeneID:5651181"
     CDS             345240..345605
                     /gene="ATG8B.1"
                     /locus_tag="LMJF_19_0820"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001682659.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0820"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0846"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0846"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651181"
                     /db_xref="GOA:Q4QDD3"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QDD3"
                     /translation="MSAYHSSNPVEARRAECARLQAKYPGHAAVVVEAAEKAGSKVHF
                     LALPRDATVAELEAAVRQALGTSAKKVTLAIEGSTPAVTATVGDIADACKRDDGFLYV
                     SVRTEQAMGAFASPCLSTY"
     gene            <346341..>346622
                     /locus_tag="LMJF_19_0830"
                     /db_xref="GeneID:5651182"
     mRNA            <346341..>346622
                     /locus_tag="LMJF_19_0830"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682608.1"
                     /db_xref="GeneID:5651182"
     CDS             346341..346622
                     /locus_tag="LMJF_19_0830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682660.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0830"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0843"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0847"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0843"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0847"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651182"
                     /db_xref="UniProtKB/TrEMBL:Q4QDD5"
                     /translation="MCREPYLLLSMHRLLLAAYWPDSDRLHCSEREWPLTEHSGAVPF
                     MVESANGRVLPWCPWRDNSVAELLAVVRGMMELAGMKLGIVVGDRLVPD"
     gene            <347474..>347884
                     /gene="ATG8A.1"
                     /locus_tag="LMJF_19_0840"
                     /db_xref="GeneID:5651183"
     mRNA            <347474..>347884
                     /gene="ATG8A.1"
                     /locus_tag="LMJF_19_0840"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001682609.1"
                     /db_xref="GeneID:5651183"
     CDS             347474..347884
                     /gene="ATG8A.1"
                     /locus_tag="LMJF_19_0840"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001682661.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0840"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0844"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0844"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651183"
                     /db_xref="GOA:Q4QDD4"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QDD4"
                     /translation="MSMYQSLIPADARRAECERVRREHPEQLPVVVESANSSHVRFLA
                     VQRDATVADLEAEVRQALGRTNKKVALAIEGCSPAATTVMGDIFDACKQVDGFLHVSC
                     ARESSMGAKDLCCFGNTGKYFADIENNPDLLGSL"
     gene            <350262..>350627
                     /gene="ATG8B.2"
                     /locus_tag="LMJF_19_0842"
                     /db_xref="GeneID:5651184"
     mRNA            <350262..>350627
                     /gene="ATG8B.2"
                     /locus_tag="LMJF_19_0842"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001682610.1"
                     /db_xref="GeneID:5651184"
     CDS             350262..350627
                     /gene="ATG8B.2"
                     /locus_tag="LMJF_19_0842"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001682662.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0842"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0842"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651184"
                     /db_xref="GOA:Q4QDD6"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QDD6"
                     /translation="MSAYHSSNPVEARRAECARLQAKYPGHAAVVVEAAEKAGSKVHF
                     LALPRDATVAELEAAVRQALGTSAKEVTLAIEGSTPAVTATVGDIADACKRDDGFLYV
                     SVRTEQAMGAFASPCLSTY"
     gene            <351363..>351644
                     /locus_tag="LMJF_19_0843"
                     /db_xref="GeneID:5651185"
     mRNA            <351363..>351644
                     /locus_tag="LMJF_19_0843"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682611.1"
                     /db_xref="GeneID:5651185"
     CDS             351363..351644
                     /locus_tag="LMJF_19_0843"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682663.1"
                     /db_xref="GeneID:5651185"
                     /db_xref="UniProtKB/TrEMBL:Q4QDD5"
                     /translation="MCREPYLLLSMHRLLLAAYWPDSDRLHCSEREWPLTEHSGAVPF
                     MVESANGRVLPWCPWRDNSVAELLAVVRGMMELAGMKLGIVVGDRLVPD"
     gene            <352496..>352906
                     /gene="ATG8A.2"
                     /locus_tag="LMJF_19_0844"
                     /db_xref="GeneID:5651186"
     mRNA            <352496..>352906
                     /gene="ATG8A.2"
                     /locus_tag="LMJF_19_0844"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001682612.1"
                     /db_xref="GeneID:5651186"
     CDS             352496..352906
                     /gene="ATG8A.2"
                     /locus_tag="LMJF_19_0844"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001682664.1"
                     /db_xref="GeneID:5651186"
                     /db_xref="GOA:Q4QDD4"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QDD4"
                     /translation="MSMYQSLIPADARRAECERVRREHPEQLPVVVESANSSHVRFLA
                     VQRDATVADLEAEVRQALGRTNKKVALAIEGCSPAATTVMGDIFDACKQVDGFLHVSC
                     ARESSMGAKDLCCFGNTGKYFADIENNPDLLGSL"
     gene            <355239..>355604
                     /gene="ATG8B.3"
                     /locus_tag="LMJF_19_0846"
                     /db_xref="GeneID:5651187"
     mRNA            <355239..>355604
                     /gene="ATG8B.3"
                     /locus_tag="LMJF_19_0846"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001682613.1"
                     /db_xref="GeneID:5651187"
     CDS             355239..355604
                     /gene="ATG8B.3"
                     /locus_tag="LMJF_19_0846"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001682665.1"
                     /db_xref="GeneID:5651187"
                     /db_xref="GOA:Q4QDD3"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QDD3"
                     /translation="MSAYHSSNPVEARRAECARLQAKYPGHAAVVVEAAEKAGSKVHF
                     LALPRDATVAELEAAVRQALGTSAKKVTLAIEGSTPAVTATVGDIADACKRDDGFLYV
                     SVRTEQAMGAFASPCLSTY"
     gene            <356340..>356621
                     /locus_tag="LMJF_19_0847"
                     /db_xref="GeneID:5651188"
     mRNA            <356340..>356621
                     /locus_tag="LMJF_19_0847"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682614.1"
                     /db_xref="GeneID:5651188"
     CDS             356340..356621
                     /locus_tag="LMJF_19_0847"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682666.1"
                     /db_xref="GeneID:5651188"
                     /db_xref="UniProtKB/TrEMBL:Q4QDD5"
                     /translation="MCREPYLLLSMHRLLLAAYWPDSDRLHCSEREWPLTEHSGAVPF
                     MVESANGRVLPWCPWRDNSVAELLAVVRGMMELAGMKLGIVVGDRLVPD"
     gene            <357473..>357883
                     /gene="ATG8A.3"
                     /locus_tag="LMJF_19_0848"
                     /db_xref="GeneID:5651189"
     mRNA            <357473..>357883
                     /gene="ATG8A.3"
                     /locus_tag="LMJF_19_0848"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001682615.1"
                     /db_xref="GeneID:5651189"
     CDS             357473..357883
                     /gene="ATG8A.3"
                     /locus_tag="LMJF_19_0848"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001682667.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0848"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0848"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651189"
                     /db_xref="GOA:Q4QDD1"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QDD1"
                     /translation="MSMYQSLIPADARRAECERVRREHPEQLPVVVESANSSHVRFLA
                     VQRDATVADLEAEVRQALGRTNKKVALAIEGCSPAATTVMGDIFDACKQVDSFLHVSC
                     ARESSMGAKDLCCFGNTGKYFADIENNPDLLGSL"
     gene            <360253..>360618
                     /gene="ATG8B.4"
                     /locus_tag="LMJF_19_0850"
                     /db_xref="GeneID:5651190"
     mRNA            <360253..>360618
                     /gene="ATG8B.4"
                     /locus_tag="LMJF_19_0850"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001682616.1"
                     /db_xref="GeneID:5651190"
     CDS             360253..360618
                     /gene="ATG8B.4"
                     /locus_tag="LMJF_19_0850"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001682668.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651190"
                     /db_xref="GOA:Q4QDD0"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QDD0"
                     /translation="MSAYHSSNPVEARRAECARLQAKYPGHAAVVVEAAEKAGSKVHF
                     LALPRDATVAELEAAVRQALGTSAKEVTLAIEGSTPAVTATVGDIADACKRDDGFLYV
                     SVRTEQAMGAFASPCFSVA"
     gene            <362688..>363065
                     /gene="ATG8B.5"
                     /locus_tag="LMJF_19_0860"
                     /db_xref="GeneID:5651191"
     mRNA            <362688..>363065
                     /gene="ATG8B.5"
                     /locus_tag="LMJF_19_0860"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001682617.1"
                     /db_xref="GeneID:5651191"
     CDS             362688..363065
                     /gene="ATG8B.5"
                     /locus_tag="LMJF_19_0860"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001682669.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0860"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0870"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651191"
                     /db_xref="GOA:Q4QDC8"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QDC8"
                     /translation="MSAYHSSNPVEARRAECARLQAKYPGHVAVVVEAAEKAGSKVHF
                     LALPRDATVAELEAAVRQALGTSAKKVTLAIEGSTPAVTATVGDIADACKRDDGFLYV
                     SVRTEQAMGGIAGLCFASDSGGI"
     gene            <363752..>364129
                     /gene="ATG8B.6"
                     /locus_tag="LMJF_19_0870"
                     /db_xref="GeneID:5651192"
     mRNA            <363752..>364129
                     /gene="ATG8B.6"
                     /locus_tag="LMJF_19_0870"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001682618.1"
                     /db_xref="GeneID:5651192"
     CDS             363752..364129
                     /gene="ATG8B.6"
                     /locus_tag="LMJF_19_0870"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001682670.1"
                     /db_xref="GeneID:5651192"
                     /db_xref="GOA:Q4QDC8"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QDC8"
                     /translation="MSAYHSSNPVEARRAECARLQAKYPGHVAVVVEAAEKAGSKVHF
                     LALPRDATVAELEAAVRQALGTSAKKVTLAIEGSTPAVTATVGDIADACKRDDGFLYV
                     SVRTEQAMGGIAGLCFASDSGGI"
     gene            <364820..>365185
                     /gene="ATG8B.7"
                     /locus_tag="LMJF_19_0880"
                     /db_xref="GeneID:5651193"
     mRNA            <364820..>365185
                     /gene="ATG8B.7"
                     /locus_tag="LMJF_19_0880"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001682619.1"
                     /db_xref="GeneID:5651193"
     CDS             364820..365185
                     /gene="ATG8B.7"
                     /locus_tag="LMJF_19_0880"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001682671.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0880"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651193"
                     /db_xref="GOA:Q4QDC5"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QDC5"
                     /translation="MSAYHSSNPVEARRAECARLQAKYPGHVAVVVEAAEKAGSKVHF
                     LALPRDATVAELEAAVRQALGTSAKKVTLAIEGSTPAVTATVGDIADACKRDDGFLYV
                     SVRTEQAMGAFASPCFSVA"
     gene            <367254..>367631
                     /gene="ATG8B.8"
                     /locus_tag="LMJF_19_0900"
                     /db_xref="GeneID:5651194"
     mRNA            <367254..>367631
                     /gene="ATG8B.8"
                     /locus_tag="LMJF_19_0900"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001682620.1"
                     /db_xref="GeneID:5651194"
     CDS             367254..367631
                     /gene="ATG8B.8"
                     /locus_tag="LMJF_19_0900"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001682672.1"
                     /db_xref="GeneID:5651194"
                     /db_xref="GOA:Q4QDC8"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QDC8"
                     /translation="MSAYHSSNPVEARRAECARLQAKYPGHVAVVVEAAEKAGSKVHF
                     LALPRDATVAELEAAVRQALGTSAKKVTLAIEGSTPAVTATVGDIADACKRDDGFLYV
                     SVRTEQAMGGIAGLCFASDSGGI"
     gene            <368317..>368682
                     /gene="ATG8B.9"
                     /locus_tag="LMJF_19_0910"
                     /db_xref="GeneID:5651195"
     mRNA            <368317..>368682
                     /gene="ATG8B.9"
                     /locus_tag="LMJF_19_0910"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001682621.1"
                     /db_xref="GeneID:5651195"
     CDS             368317..368682
                     /gene="ATG8B.9"
                     /locus_tag="LMJF_19_0910"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001682673.1"
                     /db_xref="GeneID:5651195"
                     /db_xref="GOA:Q4QDC5"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QDC5"
                     /translation="MSAYHSSNPVEARRAECARLQAKYPGHVAVVVEAAEKAGSKVHF
                     LALPRDATVAELEAAVRQALGTSAKKVTLAIEGSTPAVTATVGDIADACKRDDGFLYV
                     SVRTEQAMGAFASPCFSVA"
     gene            <370484..>372502
                     /locus_tag="LMJF_19_0920"
                     /db_xref="GeneID:5651196"
     mRNA            <370484..>372502
                     /locus_tag="LMJF_19_0920"
                     /product="putative folate/biopterin transporter"
                     /transcript_id="XM_001682622.1"
                     /db_xref="GeneID:5651196"
     CDS             370484..372502
                     /locus_tag="LMJF_19_0920"
                     /codon_start=1
                     /product="putative folate/biopterin transporter"
                     /protein_id="XP_001682674.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651196"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QDC4"
                     /translation="MASKSHLEADDNHHYLLADTAVLADVDNEYCDEYVHPGARRLYA
                     KLPFMQHIPIFSEAATSYGPGCIGSLGICYLLCKGIASSIIGYAKQPLFMNRYGLSGL
                     RYQRLSSITSMGWSIKAFTAMLCDAFAAFGYTKRWYMFASCLVGGVFGLILGLLPAKE
                     SSANTACAFIFLTAFSKASVDILSEGLYSRLMRRRPKAGAALVSWIWWFIMVGAIVAA
                     AIQGPLSDSSMVQVGIFIAAGLQAVCALIFFFNLYEERTNRVERWEDALALEAEMRLE
                     LGMDVAAEHARLRAQVQLAHKSPCSTSTEVEPITMPMKDVAPHEGQRLEASGALVAEL
                     ADAAEQDDEDLQSLEAATRARVGEPITCLFGVFEVNRDVFGRNWRIFAYSVIMTCAVV
                     AMACGNILADTLGLLILCVIVSVVCCAASFWALPLVIAKANVFGYLQMVFYLQLPGAL
                     DSFYLADEECLPGGPHFSYTFYNTVSALIGNVGGLTGITVFNYIFSKHSYRLTLVVTT
                     IVQILASVFDIIMVKRWNIAIGIPDRAMYIMGDAVVFQVCYYLTWMPVVILLSRLCPR
                     GSESMVYALMAGFANLGETMATSIGSLIMEYAWGIVTTPPCDFSNVPMLLLVGHILAP
                     ILIIPLSLLLPAARVCDDINVDGEAVKREAKKYISHDDSDTSSAAGKQ"
     gene            <376543..>379275
                     /locus_tag="LMJF_19_0930"
                     /db_xref="GeneID:5651197"
     mRNA            <376543..>379275
                     /locus_tag="LMJF_19_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682623.1"
                     /db_xref="GeneID:5651197"
     CDS             376543..379275
                     /locus_tag="LMJF_19_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682675.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651197"
                     /db_xref="UniProtKB/TrEMBL:Q4QDC3"
                     /translation="MDVLLHVVQTAAAPPASASSFCSDRTRRASLNAPAVPSASISST
                     SFTVESLWLSHREAPLGSNVADRWSVALCSRGEDENVDGFDGDPPVCVSAASPGCPPA
                     SPSSPIPSNVVRISAASVDITDLRGRRPPDGHATNSTVNLLCEKLRHSKDAIVRAGNA
                     DTPPVARAETVFFCGSRLGTRKDALYLTALHRLLVESLLIVKGRALSPPSPPPLDVDV
                     SLVDYDEGWGAGDVLAAEVVRASAYGTQEQRSQITWMPLANVLEYAPRPRSTMAAACT
                     SAITRSASPMEPSADSDWSVVRVGHLVRQRLQVWFDRIDSATSAFPSAPASPLSPPAA
                     ADRLRHLERNVVLFTLRLRSYANSSTPTLQARVSAAYFTLVLLPENGAAPPYGEAGAS
                     GAAEGLSSCRASAALWHEFEALSAFMRSLPQGRRRRDGEEHKRSGVQERGRATAATVQ
                     GKIRAAALRRSRWLTTIARIHNPPTPLMRTRVTGTGERGVDDAMGCFLKNSTVRSFSW
                     IGCIAAAASHQRATRSTLAFLSRLQPSQTAQRGWLASVEERSSESAADAHVGRHHHTH
                     KNAANNTNERVAPKAEAASSSVATSTPPLPSPRPSANVPHPYASPRLHGGSATDINSS
                     GTVWTAAASHLPPVDELSSSVVPVAAPSRVGHARCGADNDDDAFAAGAGHEPASRSAA
                     VDALIASVHLYASVLEEEVRRLRRRLQRYEAPSRDGRGSTSEPPVHSTLPEVQGCESA
                     NTSIGLSTPHTTSPGICDSLPQSVRAAIDDLRTDARFPQALHVKLDALAQRLASLCTA
                     AVQARRGGDADLPTAMQQRNEKSDDRDAYVAQLEAKVALYERKLVLMDYYVAPTLMQC
                     VDDLDQWQKHQHRQQRTRATRTGGNSNPSTTAANAASEVTPIRSVGAADHAFRA"
     gene            <379998..>381965
                     /locus_tag="LMJF_19_0940"
                     /db_xref="GeneID:5651198"
     mRNA            <379998..>381965
                     /locus_tag="LMJF_19_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682624.1"
                     /db_xref="GeneID:5651198"
     CDS             379998..381965
                     /locus_tag="LMJF_19_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682676.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651198"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="UniProtKB/TrEMBL:Q4QDC2"
                     /translation="MSHFGAGRSSAQPVPPIDSFVEVLPVAPQVERRRGILRFYGLTD
                     FAEGEWAGVELVGCEGRNDGTVKGVFYFTCAAGQGLFVRPNLIVPYAPASPTPVLEAA
                     SAKIEALEEELRVARREAVERERLKDSLHASLHSMQTELEQLRVAAVQAATKVDAKTE
                     DDDDELAVQVQLESVRLEFQRQLKTCEAELKAAKQSASEAAAACAAAEKREQQAESAR
                     QCSDAAQATLQTRNDELQTELTRLQAELATAVTQQGQSAQNSSEAAAEASAACAELRA
                     ALRAKEAEVLQLRAAHAEMSRTHERIQAAEKGCEEQQRRQLQGTARDDVLAAHASEIA
                     HLQAEIASMKTEKEALAKAQRDKEELRELCQLLEEELNEQKTQSDALTRLVEELGAAK
                     AAAEAAVEEAQQSAAQERAHLLRELEEVRAPDVQVTAAGAVSEGGVTGRPSTSSTAAA
                     EKPSLEIAFQQCRDELDEARARILQLSSSEQVVQELQHRCDELAEAMRVQRAAAQKSD
                     DVARATLAAAQQHHAQQVAQLRDACEAARHEAASMAAQLNIAAIPRDASSGHPTAAVA
                     PFVSSLNASREARYEARIRSLEQLLLECAATRMSSAIWDVPVSQTRTWRGSEVPLALL
                     REPVGRLLDFSTRDACAASAKALFQTPTTSP"
     gene            <382996..>385425
                     /locus_tag="LMJF_19_0950"
                     /db_xref="GeneID:5651199"
     mRNA            <382996..>385425
                     /locus_tag="LMJF_19_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682625.1"
                     /db_xref="GeneID:5651199"
     CDS             382996..385425
                     /locus_tag="LMJF_19_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682677.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651199"
                     /db_xref="UniProtKB/TrEMBL:Q4QDC1"
                     /translation="MPSSPSAPQREQQQQQQPWTFSVYHTVVLTKFVSALQAEVRCQQ
                     DAYDHAVEVLHASADTGPTSDMLKLGIPLYATHEEQVQALQDKYALATLETGALVALG
                     PYRLLHTLKAHVTRIEDERRAGAVAAGNGRGVRKMRVGRAPFVRKSETSIGTAALGGG
                     EAGQTPQRRGAPPMSVRIKVECIDDDKCGGVAQQQQQQSRSEHAPLVSRSPLSTAATP
                     AKTENPSATGASVSSAGGAGGGGVSDGCPPSWMTLKTEAAEPPPSSETYNGAYFIPCP
                     TPTGAPIARYVSSSVCSLSANNAVQSLSAPLPPLVAPVNCGTNVMSIASNRKRPAALP
                     SQAPKRCRSVTVSQANAVAMDETPFLSQAQRAKIVRMQEHVQFLGQASPPSSPSKEKL
                     EGDRALRLWWRVWPSSPSMLPPGAEESERQQCAAAAPPPAQHACVRPTPSMVAALIQV
                     AEHNYKRDSERCAAQQAYLATLLVAAESLGVSGAAAGTGDTENAEQAPMVTTLESLHP
                     KTVRQLQDELASKQSKLDSAYTERLALLRELTEVLRDESAVCVDEATASEAGEVKHAA
                     PSSTPHSQCRATSPSGGRKRSRRTSSARHATRSSSTAVDVEVLDADRRGGEQAVVDTA
                     VRSAAAGASALELLHSSLTDPASLMRKVHKARESLAFFSSETSSAEVTLGSRSQASSE
                     ETLNLPNGIVGINLPSLEHDRNAPELAEYLWPEDLDARIRHELRGVVSAKSRNPEASS
                     IHVVLSAAGVQQLEEAARAVSTVDPASQLRTVVPPLVVGSIMAHPKFVENGWLYVHGR
                     GETIVADVELN"
     gene            <386124..>386462
                     /locus_tag="LMJF_19_0960"
                     /db_xref="GeneID:5651200"
     mRNA            <386124..>386462
                     /locus_tag="LMJF_19_0960"
                     /product="putative dynein light chain"
                     /transcript_id="XM_001682626.1"
                     /db_xref="GeneID:5651200"
     CDS             386124..386462
                     /locus_tag="LMJF_19_0960"
                     /codon_start=1
                     /product="putative dynein light chain"
                     /protein_id="XP_001682678.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651200"
                     /db_xref="GOA:Q4QDC0"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="UniProtKB/TrEMBL:Q4QDC0"
                     /translation="MSGTRVLIKESAMPVDMQQDCADCAAHALFTLKLREQTDLAQFI
                     KKELDVKYGGQWHCIVGHSFGSCVGHDEACFIYFEINGIFFSMWRMDMTLEAKHVPIN
                     SAGRTVPTSA"
     gene            <387374..>387982
                     /locus_tag="LMJF_19_0970"
                     /db_xref="GeneID:5651201"
     mRNA            <387374..>387982
                     /locus_tag="LMJF_19_0970"
                     /product="putative peptidyl-prolyl cis-trans
                     isomerase,macrophage infectivity potentiator precursor"
                     /transcript_id="XM_001682627.1"
                     /db_xref="GeneID:5651201"
     CDS             387374..387982
                     /locus_tag="LMJF_19_0970"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative peptidyl-prolyl cis-trans
                     isomerase,macrophage infectivity potentiator precursor"
                     /protein_id="XP_001682679.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651201"
                     /db_xref="GOA:Q4QDB9"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:Q4QDB9"
                     /translation="MARFSSLHSVLAAAATLLLLALCVVSVEASYWSEEVNRVRTYAA
                     VNYLERIAKQPNVSALPSGLLFTIERRGFGDRAPAAEDKCEMHYTIHYRFPGIVENTR
                     HHPYPVRRSPSQLIPGMAEAMQLMREGDRWYLHVPYQLGYGKEGCKEKKVPSLSNLRV
                     EMELYKCESASGKTSAEIDAYLAKYMKTRIPEKAAPVDYTDL"
     gene            <390977..>393493
                     /locus_tag="LMJF_19_0980"
                     /db_xref="GeneID:5651202"
     mRNA            <390977..>393493
                     /locus_tag="LMJF_19_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682628.1"
                     /db_xref="GeneID:5651202"
     CDS             390977..393493
                     /locus_tag="LMJF_19_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682680.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651202"
                     /db_xref="GOA:Q4QDB8"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:Q4QDB8"
                     /translation="MATPATATEKDLAACTSRDGAGLLPLDGDEDAEREDEVLAEAIA
                     AAAAPATDNAGELFYVELDPESHVMTGVLPEMQRLHVRLTHLVRVLRRRVARLCVLRE
                     RARLSGDDVSEVVPASPLLPRRPSPPTTASPAPSSVYRHRDTVASNGSATHNGSSRIH
                     GGVAAASLTNAEGTTGDVDAIGTSANGHQSPRQTNPMHEPGGVMPSPRNGMNSRLASA
                     RRYTQQQILDNDSEWCDAGTFRSSRSTTAQSTPSLQPCLPPPSLQFFEEDELDDDGRA
                     SLLTCSSMAARRSYTARFRPESAPPSAQTTPNMLPANSTPYARSDNGGMLSLPPSTSA
                     VGRMSLQQQQQLTSSAKPFSGVRTACDSATSPLEGSALPPTLTPAAPESQLSLSKATP
                     LTVVDDTQQQETRAALSAGAAQPLALTDEEKKELRRLSRRVAELYSRRGLLLQQADRL
                     LCRHAQQHERWEGNEERRGCYRCRRLFSYLTRRHHCRRCGRLCCAECSRYVGKKQDTS
                     YVAAPQDTGRASIGVEHRVIIKSEYTAHITAEDTHELVEERFDEHTYLRRGYGGAGDS
                     PNLQSEKEAEVQDTVLVLDDNNGQLRGPSLEHTEDVADKLHARSRQHKWVRVCAPCYQ
                     NCLRARRNNVLQHLKSANLCILDDGFYYYHVMTTEELCRLSTALNKPDSFKKQVELMS
                     HVVVERSADYVAAAPGYSAHTLTAAAQHTPDVLRTLGSIGAYAFRSARQTANDYVGGY
                     FAGSRTILPDNHMGTAAAAHSFSAGNEAGGGGRDDDKDEACSEVSLMSVDDACSDMQA
                     PLKGGTEGNAYEHEDRPDKNTDEDARTEDPCNDGPIDVQT"
     gene            <398614..>400455
                     /locus_tag="LMJF_19_0985"
                     /db_xref="GeneID:5651203"
     mRNA            <398614..>400455
                     /locus_tag="LMJF_19_0985"
                     /product="4-coumarate:coa ligase-like protein"
                     /transcript_id="XM_001682629.1"
                     /db_xref="GeneID:5651203"
     CDS             398614..400455
                     /locus_tag="LMJF_19_0985"
                     /EC_number="6.2.1.12"
                     /codon_start=1
                     /product="4-coumarate:coa ligase-like protein"
                     /protein_id="XP_001682681.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0985"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0985"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651203"
                     /db_xref="GOA:Q4QDB7"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:Q4QDB7"
                     /translation="MRKVNRGSTTSGFACGLAAPVGLHQPRRWYFMSAAAPRATEDMR
                     IYKSKLPSVMDKVNQETTLYGYLMKRMAAADPKKIAAVQAETGKTLTYPELMKATEHA
                     AKALYQHGVRKGDVVCLCMLNTVVYGPLVYGTLRLGAIASTVNAVATASTLAYHFKVN
                     GAKVVLGMHFFQKQLAEAVALVEQETGRKVQVLYPEEFFKTDAPEIPADYDGLKGATP
                     NDTVAILFSSGTTGMPKGVQLTNRALIACSEQSAGAFGVGSQDTAVTVLPLFHVFGFT
                     ACMNCMFAYAATQVVMSKYSVEDYVRAIEKYKATVNLVAPPILISLLKNADKVKRHDL
                     SSLKRFCSSSAPLGADVVNTVEQLIPGCAVTQGYGMTEMAPTVTAPLSGQRCTPGCCG
                     VLVADTELRIVKVDDSQQSGSDKSSGIDAEPGAEGEVWVRGPQMMKGYLRDEDTIMCM
                     QDGWYRTGDIGKFDAEAGELVITDRLKELIKYKGFQVSPASLEALLLTHPWVKDCVVI
                     GVPDPRDVSFENPRALVVLEPSVSPEDAVRASDELYRFAMISMPPHKRLHGGVRVVDE
                     IPRNAAGKVMRRQVRQDEVALLKGQNGDSAAPETNRQGTTTTTAAAA"
     gene            <403723..>405531
                     /locus_tag="LMJF_19_0995"
                     /db_xref="GeneID:5651204"
     mRNA            <403723..>405531
                     /locus_tag="LMJF_19_0995"
                     /product="4-coumarate:coa ligase-like protein"
                     /transcript_id="XM_001682630.1"
                     /db_xref="GeneID:5651204"
     CDS             403723..405531
                     /locus_tag="LMJF_19_0995"
                     /EC_number="6.2.1.12"
                     /codon_start=1
                     /product="4-coumarate:coa ligase-like protein"
                     /protein_id="XP_001682682.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.0995"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.0995"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651204"
                     /db_xref="GOA:Q4QDB6"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:Q4QDB6"
                     /translation="MYTLPFIGRGSTTSGFACGLAAPVGLHQPRRWYFMSAAAPRATE
                     DMRIYKSKLPSVMDKVNQETTLYGYLMKRMAAADPKKIAAVQAETGKALTYPELMKAT
                     EHAAKALYQYGVRKGDVVCLCMLNTVVYGPLVYGTLRLGAIASTVNAVATASTLAYHF
                     KVNGAKVVLGMHFFQKQLAEAVALVEQETGRKVQVLYPEEFFKTDAPEIPADYDGLKG
                     ATPNDTVAILFSSGTTGMPKGVQLTNRALIACSEQSAGAFGVGSQDTAVTVLPLFHVF
                     GFTACMNCMFAYAATQVVMSKYSVEDYVRAIEKYKATVNLVAPPILISLLKNADKVKR
                     HDLSSLKRFCSSSAPLGADVVNTVEQLIPGCAVTQGYGMTEMAPTVTAPLSGQRCTPG
                     CCGVLVADTELRIVKVDDSQQSGSDKSSGIDAEPGAEGEVWVRGPQMMKGYLRDEDTI
                     MCMQDGWYRTGDIGKFDAEASELVITDRLKELIKYKGFQVSPASLEALLLTHPWVKDC
                     VVIGVPDPRDVSFENPRALVVLEPSVSPEDAVRASDELYRFAMISMLPHKRLHGGVRV
                     VDEIPRNAAGKVMPRQVRQDEVALLKGQNGDSSESN"
     gene            <410749..>412560
                     /locus_tag="LMJF_19_1005"
                     /db_xref="GeneID:5651205"
     mRNA            <410749..>412560
                     /locus_tag="LMJF_19_1005"
                     /product="4-coumarate:coa ligase-like protein"
                     /transcript_id="XM_001682631.1"
                     /db_xref="GeneID:5651205"
     CDS             410749..412560
                     /locus_tag="LMJF_19_1005"
                     /EC_number="6.2.1.12"
                     /codon_start=1
                     /product="4-coumarate:coa ligase-like protein"
                     /protein_id="XP_001682683.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1005"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1005"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651205"
                     /db_xref="GOA:Q4QDB5"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:Q4QDB5"
                     /translation="MALTQQVRLASTTSTPSTTATATSIAADAGTHIYKSRYPSVMDR
                     VNTERTLYEYLIKRIKAKDPKKIAAVQAENGKELTYSKVIQATDWCARALYHHAKVRK
                     GDVVCLCMLNTIIYGPVVYGALRLGALVSPVNAIAEPSLLAYFITEANAKVILGMRYF
                     RKQLEEAVAIVAKDTGRKVAIHYPEEFFKRWYIWPVPRSYDGLKGASLDDTVVIPFSS
                     GTGGLSKGVKLSNRALIANSEQLGAAFEFSPDDAGIMILPFFHIYGFTACLNAGYAHG
                     VMQIVMYKYTVEDYVRAIEKYKATINLVAPPILISLLKNADKVKQTNLSSLKRFCCGA
                     APLGPETVEAIEKMLPSVSVTQAYGMTEMAPAVTVPNGLRHKVPGACGVLVADTELRI
                     VKVDDSQQSGTDKSSGIDAEPGAEGEVWVRGPQMMKGYLRDEDTIMCMQDGWYRTGDI
                     GKFDAEAGELVITDRLKELIKYKGFQVSPASLEALLLTHPWVKDCMVIGVPDPRDVSF
                     ENPRALVSLQPSVSPKDAVRASDELYRFVMSRMPPHKRLHGGVRIVSEVPRNLSGKLL
                     RRQARKDEAELIKAQMEKASATKPKSAKEAANASASD"
     gene            <415548..>417992
                     /locus_tag="LMJF_19_1010"
                     /db_xref="GeneID:5651206"
     mRNA            <415548..>417992
                     /locus_tag="LMJF_19_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682632.1"
                     /db_xref="GeneID:5651206"
     CDS             415548..417992
                     /locus_tag="LMJF_19_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682684.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651206"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QDB4"
                     /translation="MASVVVVSASYDKQIRLWDATSGRTVKSFIFQDSQINSLFLLPD
                     TGYLAVAGFGALRLYDLSTFLHSGGGAGTGSGAGTGCSNSSSSTNQAPPVYSSFESQS
                     SMNFTSLAAVPLAHNYNKDEQSSTISGSSRQLTDSATSTILNDQLLSTVAMVDTAALL
                     GSTPCREAAFLLIATSEDGHIRFFDTQSAVTLRMLKDIATGAAITCSAVSPDRRYLLT
                     GNQMGQVSMWHLPSIVASVALEMKGLAHHKTAAASKFSDCSPITALDEADTKAGEAKT
                     AKAAAVAAAEEERAKAFGRAPLQDINFANDYSAIRSIAIEPLGRWAAVAANAGKVHLI
                     RLARDASVRGSKATTASSRSATQPLIIGVATSNDPPVTLPGQQDPNAMSLSGSVQPSP
                     YKSPGKISASESTSAVPPLHLTLTGSVSSYGEGGAANNSYHGPRETIYRSALVVNELS
                     SNAQRASDVSGDGIGGELAHTRSTPRGAASHLNSMGAVLLDHVEQQQNSNRSRSNCPD
                     GHASAAQDAQHEQLAQPSAATKLAEQLEMEVFDTIQAHYKYILRVLISPNAELLVTCS
                     ADYSVGRFLVPAALRIPSSAASAGTDTNAGSKSSALAAANAPLQPASTRLSGTRNGDE
                     GAGESKNVDEAEVRSDAPMPCFTSTQALAPTTGSRTGSGGDSEVRVQQHQQGGTTDSK
                     TDSSSPEETKTAAAAAGDTNNTAAPDTAASGPLIHSFDDIASRGLGDGISDESPQPRM
                     EFQPLKPLTGHNRWVWDGVFSDCSDFLFTASSDNTLRMWNGLMTERPQSVSFVGHTKP
                     VVAVLLCYDKRRLSIG"
     gene            <420290..>421867
                     /locus_tag="LMJF_19_1020"
                     /db_xref="GeneID:5651207"
     mRNA            <420290..>421867
                     /locus_tag="LMJF_19_1020"
                     /product="tRNA pseudouridine synthase A-like protein"
                     /transcript_id="XM_001682633.1"
                     /db_xref="GeneID:5651207"
     CDS             420290..421867
                     /locus_tag="LMJF_19_1020"
                     /EC_number="4.2.1.70"
                     /codon_start=1
                     /product="tRNA pseudouridine synthase A-like protein"
                     /protein_id="XP_001682685.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651207"
                     /db_xref="GOA:Q4QDB3"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4QDB3"
                     /translation="MFADSARHSRWMQEQLQQSRKISEYTEETAAPRLVLSHGSAVNA
                     NQLSYAVDEDENGSALSDAADAMAPTALAATTGADVLEQELLDDNFLYYPPLTAISEA
                     GAAEATHTLSSGEPERYVPGQQVIPPGMTRYRVDVQYQGSDFDGWYKSVQRTRNNKDA
                     APVGNTATAAADYGAGSRHFAKVVLEEALGVALDVPTVSVVAAVIPETGVSVRRLTCH
                     VDVPSEVELQPRTILQRATLWLHQRRQPLAVLSCHPCRNQDFHARHSGVRRVYCYRIL
                     NRIAPPLFDAGLQWHVDRYLDVPRMQRMARLMEGTHDYGFFADSKMANALRRAAASST
                     GSGRGGPVVSSAYSAEHEPLTSHGLRRGEAPAAPKVTVERGLSQLERAAALPTFNEYG
                     QRIITYQAKPHEYHKARTNLPTIRTLDKIEVVRQEDEVLIWFVGQSFLRHQIRNMVSV
                     LKAGGHGLWDDQELQHAFQSGFEVSRKKFKRERLSPAPVHGLTLWDVEYPAQHRSDFV
                     PYVDAGPYEPVDVSTQH"
     gene            <423069..>423929
                     /locus_tag="LMJF_19_1030"
                     /db_xref="GeneID:5651208"
     mRNA            <423069..>423929
                     /locus_tag="LMJF_19_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682634.1"
                     /db_xref="GeneID:5651208"
     CDS             423069..423929
                     /locus_tag="LMJF_19_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682686.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651208"
                     /db_xref="UniProtKB/TrEMBL:Q4QDB2"
                     /translation="MYRAHSKDINRNKGFHPLTYRNLRRVEQLKEEAELNKQKAEERQ
                     KELQRDQEERRYDELVLANSADSLSGELARYRQTRSIFAAEYEADAKAAKDASVASLP
                     SPQVSKPEVQLKTSAGASFPVNSFLSKFKKEESYGSTCVMVKAEARDNTAAAASSAVA
                     SAEAETPVRKRPRDDATSNSPSSTHNGSGYGEGATKRGGDGGESAPATGFVTSAEAAQ
                     LRKELNLAQKQRHDPLMRVKEYQNSCVAAAARQLDHEQATGAVAKREDDQDKLQSRIR
                     ELLALKKKKK"
     gene            <424848..>426749
                     /locus_tag="LMJF_19_1040"
                     /db_xref="GeneID:5651209"
     mRNA            <424848..>426749
                     /locus_tag="LMJF_19_1040"
                     /product="putative phenylalanyl-tRNA synthetase"
                     /transcript_id="XM_001682635.1"
                     /db_xref="GeneID:5651209"
     CDS             424848..426749
                     /locus_tag="LMJF_19_1040"
                     /EC_number="6.1.1.20"
                     /codon_start=1
                     /product="putative phenylalanyl-tRNA synthetase"
                     /protein_id="XP_001682687.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651209"
                     /db_xref="GOA:Q4QDB1"
                     /db_xref="InterPro:IPR004531"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="UniProtKB/TrEMBL:Q4QDB1"
                     /translation="MPTLAVAKDYICRLIGKSYTDEEFSDLCFQFGLELDDITSEKEM
                     FMREQGKSAKANVAPAEAPAHLSEEKLYKIDTPANRHDLLTAEGMACALRVFMGTMPL
                     PNYRVLNRASPLYRMSVEKSVKNVRDYVVCAVLRNIHFNERSYNSFIDYQERLHAGLA
                     RRRTLASVGTHDLDKVNTTDFIFACRPRETVRFVPLRQTRELNCAGDGLAQYYAEDRH
                     IGKYVPLISSFPTYPVVYDGTGQNVLSLPPIINSHYSAISVDTRNIFIECTAPDHYKA
                     QVLVNQLVCAFSVYCEDPFTVEAVQVNYEEPTPDGTRSLVTPTMETKEMTMNIERLNS
                     IIGIKMKSGAECAQLLKMMMYTIKETTESEVTVTVPPMRTDVIGVADVMEDVAIAYGY
                     DNITYVECKTHGPVTQTPLSKVAQLLRTEMACAGYTELLTLSLCSRADAFESLGRVDN
                     DVAAHIANPQTMEFQVCRPSLLPGILKTLATNKSKPLPQRFFECADVVLLDNERNFPP
                     VLELKTDYASCGARNQRHLAAAHCNGSSSGFESIHGLTELALLKLGVPSKAAIADDYE
                     GDYYTLEKGEDGAFFPGRAMDIILHRAGQAVRIGHLGVIHPNTLKAYDIPSPCSYMEL
                     NIQFLCVPL"
     gene            <429442..>433092
                     /locus_tag="LMJF_19_1050"
                     /db_xref="GeneID:5651210"
     mRNA            <429442..>433092
                     /locus_tag="LMJF_19_1050"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682636.1"
                     /db_xref="GeneID:5651210"
     CDS             429442..433092
                     /locus_tag="LMJF_19_1050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682688.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651210"
                     /db_xref="UniProtKB/TrEMBL:Q4QDB0"
                     /translation="MIDVRKGQRKSKRVNPKSTMASIINAHRAEAQKAKEELDKDDAY
                     TPPLIFLFRTDDTKKQAARRQEQIDAQLDALSAFGEFRACVLDGIKSRHWTRYIDSPT
                     TPNRPAPDKAESASSGDAPYTTYVAVAAAAPVDPAVVSANGTGDAPAAAVPPRVSAAG
                     VAEGTTGAAKEADDMEGEDEEVWEEVEVEEGEEVVEGDDGGGGCTNSAADNNGAGASQ
                     SCEAATYVDHAAAPSRRANEARTTTPVDEIITAPSTAKRSVNTVWAHVTSQTHSGDSD
                     ASAAALVAAAEVLSRKQDNTVEEEVVGVADLDGEDVATDAASPAAPSPTDCTDNADGV
                     SIPDAPRRSGPERNNGGSVFLAAAHTPPLAEADAKAAALARSTDAETLLSLEELEEFD
                     IDGPLSEGIAPEAPAASAVSALTDAAPKALSAATTKHAESRATEHVAAVSVSGDDDVS
                     AAGEAAGEESASVPTSAPPALDTAAKSLTEVLQENAAACVAAGAADDGPALTASEGDS
                     ADTEVEGKDAEEEAVATTAAEDNADAATFSVAAPATPMSRPKPSISMPVYPQVVSRLY
                     YGATTVYLSDRAFIELPPTANVLVIDHLDWDDAHLAAIDAALEQVDPVAGHVLLYPDA
                     YAPQSEHVIGNIHAYRRSLLPFIFVFRTQLSNEAAMALQRRLANALHVRPTLNSAAQQ
                     SLMAGQNDRTSVCVLSAAESERGGENPMLAPQPRKATPASPKPSPAELARARNATATT
                     VAEAPRRATNAPVSESSTAATASASPLPRTPPGATEGKHTGASTRGVADDAVQRLWDV
                     LNSVSFDASSSKKSVASAAAPSAQVEVQRSHHGGCNGNSGAAAEWQQRISVPGASAVR
                     GNADQAEPVYRRPVDTTTNILTSTSDTGETGNGHITASTVVDDAASSQPSRLAYASSL
                     LNAEVAAPFLNASTRADAAGGAIAAHRTPPATTLLAESAEVHGSTAMIKGGLFNFGAI
                     TFGRDNGYCTAEVPRPRRAFSSRWGMNDDDDDVDSEHNATDAADGAATSSALGSVSDL
                     GLYPVSESVAAARAEAARINSQCGGGSPFTDEEIAKIEEEIILAQLRKQERKERRSEA
                     RRAMRAKVKEAKSQFSCKTASLPSPSSSPVSSAPSSPKGSRLWKQRLQGSRSVSASSK
                     ATPTAREQELAEDGLLEDFSSLLVNRNRGRGLKADKVRVSVASAPSRRVARSARRTLA
                     TATSSTRRGVRQ"
     gene            <434501..>438253
                     /locus_tag="LMJF_19_1060"
                     /db_xref="GeneID:5651211"
     mRNA            <434501..>438253
                     /locus_tag="LMJF_19_1060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682637.1"
                     /db_xref="GeneID:5651211"
     CDS             434501..438253
                     /locus_tag="LMJF_19_1060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682689.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651211"
                     /db_xref="UniProtKB/TrEMBL:Q4QDA9"
                     /translation="MLRLVGCRLGGRVRRRSKSAIIDAAVNAVLAELRAKATKAKKSK
                     RAATSTPAAAVKAPAKRTEQLEPPPAGAPPPPATTAAPAKAKTRNASKNLVDTVLSGV
                     NCTLLKHVLSSSSSSSTSTDIPDVGRVLRLDYTTIARKHQLAHLADILLVNRIHAAVV
                     NDTHERTADGASGAAADASSPLVVLVETTLPREDAEVQEFIIRNALSMHPLPPEVATE
                     DGQSVHTPPLTVLVLGDEQTKRVRTLAELPPVPPRVPAAAPLATAPATNSHDNAQAAS
                     AAPASDRSAAAEAAPSTTCDNPARCSLSGAPAQGAPQRKENPKEANSSTPPKADAAET
                     ATAANAVLPSASSSPVAAAAASAESVPTLAATAAAANTAPPVKTAASEVSTKRVERAV
                     RRVARVSLKALAAQKKRRPATPSQARLVASIAATVSGKHAAVARPPRLLSVDSSKEKL
                     LWASQPGRPLPIRILEPLVSPAVYEEVRTAAAADASASSVASPLTMHMVVYGVSKESS
                     ASTVWLGALQAAAELTSAMSSGASQLPAEVAELAGLDPARVRRVSERKSSRKRCNTKA
                     AAVSSVSDDGTATAAAPMSPKPYVYILIHTRLSREDAAVLQQELQYQLMQLKATPAGA
                     EVAGMSVLTAEDVSPAHLSYVLEHSMVEGGGDSVKMSAMRRGCKSGMVPSAAPTLSAE
                     AAEVSNTFQEVYRLLSEQPWLLSSPLQRETPSSSSPRQQHPDTLVADAIRIAALTQVL
                     VQRKEAQLRGHFEAAQQSSAMNADSEAVARAAQRVEMKTMVTEAVEEVSVRHEQATAH
                     LVKTLSSIVGQWSLEKLSDTLEAIVRDEVKPIMDVLEERLASTPGRNAEAAGGEAAPI
                     AAAPALMATPASTSPTDSADAASSVLLERQDEIKGTMSQALAQLRELSERLSALAAAT
                     TAAAAAKTEGLVGSAAAHPPETAAAPPKSEEELRLLRNLHELQEQHHSKLSDGLESLR
                     SDLRYFASQERAAAEAQATVPAAAYAATLSKESLDRAVADTVHEITHAIRRDLHASVV
                     EQLDAYCDVHRSTQNSAREDRRDEEPSTPVLPVTSFELEEMLTRVVEHTVRTSTDKIE
                     DHVRAAIEKSYRNQQAADPASVTAAASTTSATESDEALKAALERLWAQVRAEAAEEEA
                     VKVSQHNRQLLRLLRRQKHLQRCLPGCQATSAPASASSPASPLSYVALEEAMRVVMHP
                     YMAQMQATVAAAAAGSPRTSVETSSSTTSADDGVEQDHAAHPASRK"
     gene            <443450..>446350
                     /locus_tag="LMJF_19_1070"
                     /db_xref="GeneID:5651212"
     mRNA            <443450..>446350
                     /locus_tag="LMJF_19_1070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682638.1"
                     /db_xref="GeneID:5651212"
     CDS             443450..446350
                     /locus_tag="LMJF_19_1070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682690.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651212"
                     /db_xref="GOA:Q4QDA8"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:Q4QDA8"
                     /translation="MAFALSSQKADAGVLAAMTHVAVSNPTAHTTTLPRSCLYVWVVG
                     NPTSGGERGAVLLDRLEKLFCQSFGRDTVHTASSSNLLHILSLHQPVPGSSSEGMESG
                     EHVHSPEAPSASALGPTAGSAPSYSSAVSAVWNATAAAMPANPPDCALSSVASSVGGV
                     ALRTLIIRTNQCGHLKPLSHALSQLILCSRLDDHQRPPQGPMLSSTPRSAIASATLGN
                     DNDKHKSLPLGIERTSATYQCVSSSRPDQPSPHHVILVVGGDGTLSEVTNGLCDGTLA
                     GFAQLALSSGCSADAAAVTSHAHVEREAAVLSHLLPAVLYMPAGTGSDFAKLELCCRT
                     PEDALRVVCDGLARELFPVASSRGCDDVEHVDSEGCRSMALNSPAARQSISAPSRSSA
                     CAAYAVDVGRIEFLRTGTRHFFINECSAGMSCDVIQRGERFKHCRWISMLGGLVLFAA
                     SSFVSLVLMKPKPVYICKLPPRVPLSAASAAGAEDVDTDGGATETDASQEQASKESIG
                     GNDNYAAGVCSSDMDCKSISTSPLSDAASDSPLGWPHSLTSLAPFTPLSKQLGRLCAR
                     LRRSAHVEPRPDAPGHRSDGSRDASANYRTRLAAPAAPAKDCAAAYTLHARTPMPPLH
                     AKKVRCTLQTPSHQILQLLDISPEKLEMHRMQQEQRDTGAPAVTSSTDFTTATSMKGM
                     GRVATSKGTAAATSSGEDMVQHEHVRCKGNAQIGSDDHIGEHRCRGNSGALYVDPATG
                     KGDDAWPRDVGDDDLISLVWVELPSSMIAFANGRWYGGGMLVAPHANPTDGLLSCTNW
                     VTKILPFLFRAFSLYTGGHVRWRSTSVFDGERFLITSGPPPSAAEAMTASLHSLADAP
                     LDAEEALYMEADGEVLEAAPAIVELAGKLIFLVPSTATVCLGSAAPGTTRERVAAQQQ
                     QQHDDGARLPSADTGVVLHPPGRRLGGLRDGLCSLLRRLANYAKQRIGKTRS"
     gene            <448100..>459403
                     /locus_tag="LMJF_19_1080"
                     /db_xref="GeneID:5651213"
     mRNA            <448100..>459403
                     /locus_tag="LMJF_19_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682639.1"
                     /db_xref="GeneID:5651213"
     CDS             448100..459403
                     /locus_tag="LMJF_19_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682691.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651213"
                     /db_xref="UniProtKB/TrEMBL:Q4QDA7"
                     /translation="MIFIEPDVDYFRLHLWDVRVPVPVLEQGPDAIAAATASAPTSVR
                     ATVVPQCKEPDNGGHDAPLPHKGLKVATATETAGARRSGSAAPSVSSSTDPSKVLAAD
                     GEHLHRCESGNDDYRGLLEGEAASCAKITLEERADVVHRALLSALHARFPYEAVDTLE
                     YVYILVVTHHVAPSLASQAFNEDELGSLTSLSGLLPGELRDRTFPSHLNAILDPASAF
                     AAAPTSAKPVSPETATGVAADSAAVQVLHNAPTTPHFFDSIFLLSRALTPEQQAIYYE
                     VQRCGRRLVSCEAVHHARAAAAKVHQSSGTNPQMESFSVIQGRFVHCVPADGSGGGSA
                     ETQAASTATSNSGVRRVVGESQSYRVPSSEPDGDRPAQAASPATTLLPAARSLYFSVY
                     RIPLSRFHPAEQQYYADQREELRWRQRHRCRSSYRKLQQKGQPVEQASRAAMPSCGLW
                     CHPQEGSDRVDAARDACSCSSGSESEGDEEDWEGEVGRSREKAVSSLSSAKSRRTRDA
                     ADAIDRLLCSEGHGVSDAAEQTSTAEQRSAARFFRTCHEVLTNYAIAHSPYAATGAVE
                     KEETAARTKAAAHGAPSPSLPAATAAVPSSAHQRQQHPRMPWFPRRFAGVSYVGVTRL
                     LYSLAPCDCYHLVMKDHNPFYYARSSRASYESQTVPLCLVSDLSSETGGDGSGALQLA
                     QLKSKPLPRATAAPATAPASAADARCRRFGEQKVQVAPPRVRSPESGVTEQVLLPGCT
                     APGSRADTLAVADGAGGAAAGSGREGLVCTPFPSRSPSSERADRTSSEARVAAAATRH
                     TTSNPPPSSASPQSRGSLVSATDGFLRVSASLICNNISGNPQARQQSLAEKGVHVPSF
                     LLPDDVRTRGGTDAGPSCRNPHDAALAEGGAAAAAVNLFKALSQSSLAQHKLRHGCIR
                     SVISVAVLDSSQRMSDDSPAVCRSGGASSDGARRYGTLEATQMQLSQHYCCRGLVDHT
                     WLSIPVQCTPAEQDAIQWMPVMLGSTDCVSDVGLRTAVHLGIFPRALPPSRSASGGPP
                     SLTAACSSTPSDQLDGVLPTRDDALSSLQLFKFRRENPTAALRQTVSSGAAAAADNAL
                     AGARLSNSKKGMSTAMPPVAPLRARPVNRADDGVAADIDVGAAPRKIQESGPSAQGGA
                     ENGREAASTPATTITQARSSTFSAVGRLEQARTPLTSFSALHTKGGVPLAFDSTGDRQ
                     SHAVPWRGTTPWGRLSFTATTTAEKGEMGSEHAHVAIDDEEEQLRAPTPPATATSVRV
                     ERGGIALTFDAGPTQQRKPPSSSATGGAPTTWRRSTHPATLSARCSAEFPRDCSRYVD
                     GAMKGKDHNEESVEVALDFSDGDGDDPERRMSPSCAHTPARTPRALAWTPLRGNQVAQ
                     ELAAAEDADNERRRGGGGSKVSEQVSGAITAAPKSYSFGARGSSQAATKVTNWPDKSL
                     RNATATRTGSRSGGSLHFPSVLHTAVEGTVMEDKEQLDVNRSVRGRGAALMPATYGAA
                     AERRAGVFGTSGSKNISRSSGPLPASLPAPRSNPFLMQTHKTPAANSNQPYYIDTGTP
                     PHPSPLPRCFAGYTPFQPASGLPQHVPRHQQQTPIPTSRPTSVSATPTQRFSVPFTPF
                     GQGAELRYQTTAPTLEQQLPPHTHQHGARATGFAAVAAPYSRVPPSTVDLSASAVSLS
                     SNSSSGSMCLPLRQHPSASPPPQECFFDDPVASRTTCETREPRGGTASTATPTTTSDG
                     GTAPRGAQSAASPSAYFAMAWNARKTAPQQHRLSGGIAEHPSSSAWLSPLPQHATHEQ
                     ARAPQSRPRISFYPPLTAARSAPSLSAQLLNPSAYYTPPARQTIGAGRLSLFSSPLAP
                     QRGSGGGGGGPAALAVDACGLSRSLFIDEYDDGAVTAGSASHLRGDARAASRVRPRGV
                     SAMDAAWWQPVRELTSAPNLHHGAAAPAAGHSRSSMSTLRLPGADQPYNLPLGSTSNP
                     HSHSGSLCGDCGGCRKGCATAAGDPALQQRRRNSCYHREASSLGRGTATAPVRPSRAA
                     VPPLPTSRLGGLRIDARNAEKQNVDDAYVEELSLSPVTPHRTQMRTPFAVRRARRAAA
                     TTGHSFGLSSRRRPPLAPRSAGGDAARGSSCNCAEANERNKSRAHYGAATSSSTAAWR
                     DGLSVRERVQLRRWQLDKEERLASYRTHLQANYLCGSMPKRYCFERQTGGAAADTRPA
                     PLSGDVARESGVTGSSEQPQSAAGGYAVWTPRTTAVPPMGHETAAVLQVGKSARDFSL
                     GVHSFAPVSTATSASTASGAGGPDVDAARVYQAEAHLRQQANTQSQIEARQQMKALAD
                     GAAAARLVTGVNVSFTLRDVATVFLRLPRTSLHASRTPGTAPWHVSGGAGLDVLDVCD
                     AVWRTEGVSCFLSRKPTQLRGGWASYLERINLYQAPFFLRDQAFVLLLPVPHTPTLKV
                     CVAIHSISDLLALVCQTPVARILPTAAETWMRQREYGFEDANDNAEERQDGAAMVVAE
                     RRWLFGLFTTRRLVPAAGARASRKADRQLLSPKDDNVKRREKCRRLRREYQADGLCLT
                     WRHRARLWYALLRAGLSCLALPACTSPLLIDPVACNARCALLCDRIAAYAVAHHRLET
                     LKAIRQSYLETRAAELSKERVGRLCERTHHGTARGIQLGGTGGSSSRVAASRSQCTPS
                     PLLPSAPTRQQRRVSGVGDDGVDSTVHQGRYPVTWGRTCDSTLRTGLHGRFSSTDEAS
                     RDPRMAHGGVVSTLETPSTTWGRPLFAASTSEAPLHSGHFEASRQRFDDRGDKRQQRA
                     GTPIPPRLSAIGGISRTHPSLRQRDSSRDRWATPPPPRTTRSMQLRLAANQRVAAGDA
                     PVSSLRHATHASVLGEGRLTFSDGEQCSDAFGLHSRRSFTPPPRPPPSRPPPPQQQQL
                     QPRWDGGFGAGATSTWTANGRDGAVGVPWQQAHTCGDTVATSCRRESTLARPVAGAPG
                     VAFVNVLYDAEAGSHPYASDGARGTMHAARSATVVAADKSHASSAASHGLFAPAASTV
                     APYASGTSIVPSSDAQATAAAENGAQRVILSSTAASSLARSAAAASTDLDLILRVDRD
                     DASASVLAGLTEHRAVTIAPPLVTVLSIVPLAAQPVRGAGAGVVEDGDSPTVKPADTG
                     AASPLYPGFIPTPLEVQQRLAQPFNLSIAQVQQLLRWQWEHHQHCYTLMPVPLFTGAA
                     AGPTEVDFSLRFWSSPQSADSVSRGGLDERASAASPSYAVSPLARELLLHLLRWSWLL
                     PTDYEASRRSRRHRLAATTTSSLASLFRCLISPSPLRCPRWRTLALIVLLVTAAEHSA
                     WCLQALLFGGVGYCAMNGVTVGLLTQLPSHRGASRRRDCDGCLPWHWWWGRWSTGAAD
                     VCSRGGRCSASRLVRRPLSALQDDVPPIDDRVSLLYSVGESTTHDMLERRRVHFAAQV
                     VLVRVLRLQSAAASLLSRLQLFLYGYSTALSLWVALLLLAYALLYVVYREAVLAVHQS
                     RGGAAWSAACNGFASAETVSAFWQVARRILHAMWWNTNAASTTACHPSQSAASALTGA
                     ACREVLARARYILLQRQRTVVDGVGEAATAGVASGVEAQLLSGSDPAVKATERTGGSA
                     GAGAAHGHYRSPSHFYQNGKYFAYDAQLPAWAKSEAAAAATPSSIGATPGAHYERVSA
                     QPQRQEPSPSASVVQSLSAWFSHIVQDGGRDGNDGSGKHQPSALCNHSADPMGSNSTY
                     VTANSSAAYKCPNKAAGSSVGDPSVLWFLVVAYVVTVCLPWSPYRWLWRRVWSVLMHD
                     DALARRPLLTV"
     gene            <459788..>460438
                     /locus_tag="LMJF_19_1090"
                     /db_xref="GeneID:5651214"
     mRNA            <459788..>460438
                     /locus_tag="LMJF_19_1090"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682640.1"
                     /db_xref="GeneID:5651214"
     CDS             459788..460438
                     /locus_tag="LMJF_19_1090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682692.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651214"
                     /db_xref="UniProtKB/TrEMBL:Q4QDA6"
                     /translation="MRMRRSTQHIAPRWLADACACTLARCVGDIDRVRVYELAIAIMG
                     VFAARLSPCMGGLCAALLSVVAHVHHLSLPAPCARSRHLRHIEWPPAHFLFLSRCRPP
                     PLISLLVRIYRQQMVMRQRMDAHDSGGGGVFDTYEKLRQANSDKLQTLLSRTARGRGA
                     AGGAARHVKKSASLTGDYLDFENDEFADKWINIGMGLMVALALFLFYVLWFTDWVQ"
     gene            <462665..>466621
                     /locus_tag="LMJF_19_1100"
                     /db_xref="GeneID:5651215"
     mRNA            <462665..>466621
                     /locus_tag="LMJF_19_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682641.1"
                     /db_xref="GeneID:5651215"
     CDS             462665..466621
                     /locus_tag="LMJF_19_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682693.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651215"
                     /db_xref="UniProtKB/TrEMBL:Q4QDA5"
                     /translation="MNDYDELYEDDFEDDELGSVAAKSASCHAASMSTPHRPVPATYG
                     TASKSGVITSTATGHTGAAAKSGMESAPRRPMCSLGSSFSSYQSSSDDPLLRSAHEHC
                     CSSSTSSSRHHTDPQHPTKDSGGPPSAAESVKGHRALPDTDDANAVVIASDFVRTPMS
                     PRNLSAVTPASGCPSVAQTPGQREIASSGTPKAYAKLDNDDGVQVIASMGRKQLRPMS
                     PSEASATETAASSCTSFHSTSHASLSPGRAGSSRHGMPRAGSGSVSETGAKHLQRVKF
                     AGNASRSSSVASCSSDDDSGSGCGRLHGTSPTPFTSAAAPPAAAVAPGIGAPVTRNVS
                     AERRHSGSSSITTYSVKKLLHQSNYTSVDVLEADDDRGHRLTPAEIDAAAAPVDDEEG
                     EEDHEDASASNTMLPVAALTAQRQRLASSPSGVHSGSFTSLTPSTPAEPSLTSHEPPS
                     AHITTTAPSSSMAPTTRSSSNRAPPQNGPDSVSAHSSSRPHNSTSAVALQTSSNDASR
                     SRSALCEASPKTQATSGAVLRGAIQRRQVTTVCNDAMDARLLDGVCDSQGPRDDRGDV
                     DTDEDGVEKKPQRDARSKQLSSPPPPLPPSRTFQLSTTTSEDASLYEVGTAKTKGHTK
                     VSTTAAKDGNAPESGERAALLARVAQLREEIATWDNRIARQRALIKAEAGRSDGAAAS
                     SSKCRSADGTGVARRRRGSNGGKQRSESVEQALHTQADAKGDGRPVNVRLTKLRRENE
                     QLEAQYARQGAGEAEMSVQALVVRADTQLQKARLRLKEITAVRRALENRDKRAAHTIK
                     EVHRRMPTADELEERQHNEGIYSRKGLLRTVKELKENVERTRAATKMMKARCAELEAH
                     VRRKHLSSIPLKEYEALCATRDANVKAIEKHKTAIFVYTIAFAHELRNGSKSTCGGDA
                     GVCATQSSRSSCTTSPFKPAISPVRAGATAKEQQQVIAEYEANKADRLLQQKRILLGR
                     KQELQASIDTLLQRVEEYNEQIKVNHAQAGLGYLDANSAAVAKARAPLYAVGGSSPTR
                     STPATTSAVSARDCGVLVAGSGAVVARRGSLRDVLRSPVTRRVEAMEAAADAKGGGGA
                     AIKHLRGGAAAARRRTPENANGHAKHSNLGLKALPALVQTGKRTARAEDRASLPALTA
                     VLGSPVKAAAAQMGSSIAAGGEMPTSSRNAIEEELGDRDSIEAVLRRIDADNTRLGYD
                     MFELEGRERAAPPAFPENTHDADPVKVADNVPGDGDTFEVELVPHNVNEGDNGGQAGG
                     AGHHDHATSAAERLRGVYDRAMPSEPPTEEEEVEEELSAGNSDESGRSTPEWLRDD"
     gene            <468885..>469919
                     /locus_tag="LMJF_19_1110"
                     /db_xref="GeneID:5651216"
     mRNA            <468885..>469919
                     /locus_tag="LMJF_19_1110"
                     /product="putative mitochondrial carrier protein"
                     /transcript_id="XM_001682642.1"
                     /db_xref="GeneID:5651216"
     CDS             468885..469919
                     /locus_tag="LMJF_19_1110"
                     /codon_start=1
                     /product="putative mitochondrial carrier protein"
                     /protein_id="XP_001682694.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651216"
                     /db_xref="GOA:Q4QDA4"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QDA4"
                     /translation="MSSSEKKHAAWVDVVAGGFGGALAKSLLSPFQRIVVLQQLGQHK
                     SYSIAQLVHHIYAQEGLKSFWRGNLTSMVIRVPYSGIQFLLYTQLKFLFQDWLDRRHA
                     AAALPTHQADGSSDNSNTSSAAASRGLGLEKFVMKCGAGGISATIAGAAVYPGEVVRL
                     RLMSGEKKFTGIANTCGLVYRETRSLRNFYRGLGASLMQRVPDILVSFATYETIKYAV
                     LDSPDPLLFKGNDAARNVLSTMVGGSAAAIASILVAFPLDVAKRRIGMSGQGTDKTVY
                     RGVGDCLRQIYAKEGIRGWYAGAFVEAVRCVPQVILMWMFIEVIQTKLSSYARVASAE
                     DEMAKRKKGP"
     gene            <471124..>472362
                     /locus_tag="LMJF_19_1120"
                     /db_xref="GeneID:5651217"
     mRNA            <471124..>472362
                     /locus_tag="LMJF_19_1120"
                     /product="putative proteasome regulatory non-ATP-ase
                     subunit"
                     /transcript_id="XM_001682643.1"
                     /db_xref="GeneID:5651217"
     CDS             471124..472362
                     /locus_tag="LMJF_19_1120"
                     /codon_start=1
                     /product="putative proteasome regulatory non-ATP-ase
                     subunit"
                     /protein_id="XP_001682695.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651217"
                     /db_xref="GOA:Q4QDA3"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="UniProtKB/TrEMBL:Q4QDA3"
                     /translation="MSTPEARAQAYLVNLRSRLEAKNNASAAATVSRALDYFEQRFWY
                     ELSSELLQLIRDPMVLEDAYELYADVIVAVRADISPIAYVMIVRSVCFAPHSTTQTAL
                     ELVEGACASLIHSSSEQGHYAALCIRALLLLESTSPEESAALAAVPGSPPHTARKLLE
                     QTEMYLHGLKMHEVEPVLVALYGMARGRDYEIRRQHTSYYKNAFDIIIFLEKADLPMR
                     DEDVTALAYKTVVAGLLSDKIFNFGKLLNFDQFVSRLQREACPQRWALEMMRLCNEGD
                     VANFEAFFRQHQQQISQEPQLVSASATLHRKVRLMALLHLIFYTPLSERTFTFHAVAQ
                     RCGVPDSGAEPLLLEALAHGIIKGRMDGLKREVRITWVESRVLSLEEVKALAQHVSQW
                     REQVVGLTNSVKEMTKKIPQ"
     gene            <474617..>491887
                     /locus_tag="LMJF_19_1130"
                     /db_xref="GeneID:5651218"
     mRNA            <474617..>491887
                     /locus_tag="LMJF_19_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682644.1"
                     /db_xref="GeneID:5651218"
     CDS             474617..491887
                     /locus_tag="LMJF_19_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682696.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651218"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4QDA2"
                     /translation="MRTSMETAVQLETAPKMALQETDAVRHTPQRPFNEALQAEAATY
                     LMHEREADASAELSRGGLYSLAMRQEQPLVPPEVLMELKDGEQADASVALLEKLNPCT
                     CTTAAFDAWLRAVVKSIPAPAEAANAVQRGNYCGSRAIRGRARPGGVTGVSRQQALYE
                     ALEALEAAARLLQRQAVLCRGRNRLLHAYYDALEEDIHQHAASISTSTAASDTVHLTA
                     EIQLQQLLPPEQHKFSPFHYHLRLYKRGAPLQHYTQEQEKLQSRLEKVYYVLLKLEEV
                     EGLSNSILVEGQATPLLSQQRRQSTGDLQGGSTKAGPIMRANVRKDGIGARNSTDSHG
                     ALTLTGGGARRDGENEPTMNELTSQFSRRLVGMERRVRRLRRQLRLPLPVSEVTSRLR
                     NELILSFSARVLALREPAPFTSEIYVTSAASPSSQAAPRPLGGGAHHQSSHSICAFVE
                     WYVQRVMDPLAISQLLNIVPREYVVTTTCRLVYACEAHASLRSSRALPDLGPVLLRAV
                     AEGRADAVAQLLLSSSVSYGSVLSHPVDCQTCFFAGLLGGQLDVLTRLVEQQSWHVNA
                     LHVLLFMSAPWNIAAAPTAVMSSRACYVYQQALVERVQAFLSVAEQVLAARSQEPAYK
                     LPLSFEENATDAVSMSNIAGGADHEADESALAALRNAQLLDVSAGGEKLLATLGFLLL
                     SAASSASVDDDALRGGRHGSQHSNHTGKPATTANASMTRGGGIKKAEDANDADDDDIT
                     GSTGVSAFGALSMSAASRAAPVPPPVFLNGALHRLQLFLAVRNAMLQYERQRQDAQWE
                     TLLGKFKARSSSGDGASSAATSTMHGLGSSGKSLARLHAKAPPPLQGAAAANPRTDHR
                     EAPLASAVTAPSSFVHILQQHQLDALTAVAVCPLRCQMCPAFTTPQLQRVDAWSYGPL
                     QPTTAITTTLGTARGTGSEGGAKQSSRELISLAEQEKTLIGIGGDDCRHDENLRDRLN
                     RSLSSLSPRSQPITALLMRSDTAIDMTASSWYVHATISQANFAEEHGHYGSSSNGDGE
                     RQTARGTRLHRLVNPWQACSATGLLMSALPVRYSLSMPLEDVRRAAHDEKQRQALRTL
                     YGSSATGAAGKSVSDHHDDGDGSGDHYPWRSGTGTAAENLASLCVHRAPPPPAKPSFY
                     YEVQMSVEYLVAMHAADYLGATPPAIDSEVLARGASSPLSEDAMHRLCENCVVVGLCN
                     PITAAQANGCTHSSSPPYVVTHLGHECGAGGAAQDKERGGSGSGAWSAGVSVSVIAHE
                     QVAASRLLSTRVTAQASPAAAAAVVVEPGEASTTPSDDDDADTDVLYLAVWKHQRNSV
                     RAITAMQSPPYDVGGDAADACANAAPVYLRLELPRWSYPAPAKEAGTTAAQDAPRNRV
                     VAANGNPAHTTEANAAAAAATASTNMWLPIITRACQEDVARAVTKARQQQAEAGQKTA
                     ANQASERARKSRCGATSPSLPASSFASLPRVRCEVAATLVLGLLFDPSAGTLRLRLNN
                     YTDFEEIALGLRLGSVAKATAATTSAAPPPPALQSRLYPAATLSLNDCGWRSWYDHQT
                     RTWARLQQQQQQGAQPAGLSSGKGRGRCAPVEYSAPPLSASSPSSSLSVSNAVLRFSF
                     DAAELLLGPPPPHQGVRVTSADAMVAAGKTARMSHQQQRVSEPIGAKAPHSAVPPSQP
                     SQPIALLDSTVKFTEMLSVLTDVSLIAATKRSSNKNQQQQQLPSLGHGDDVAVEDEEG
                     EFDGVDAAAPQGAAPAAHSSLLLIGSRDRRTHAAMMQVQRLLNTPGGGATSTAAGSSS
                     VFNNSDPADIFYPPVRIYRHSCHCPPHELYPLPSSSSPDAADKNDAGERSRCTQQCQR
                     RLGNRRMGLSSAGEAPSLFSVNVYWHDIVPENARLTPLCAALASRQRTMAYVIATHPL
                     TCFCNLSAGEESACDAYVRQQQQSQQRRTALYAACALGYVEVVQVLLERIPVEEILSY
                     FGLVIESEARAALQHCYAVANTTFLRNYRLRSLATQSPSSPSGTDRVDGSATVCSTAN
                     FRDATTAVVPAAQARKSGGAAAETSAPAVPYLSNESQRALLDASAIYSSSRSTYTPLH
                     VVLLGVVLDNGDQDDEGVEEGSCVDVGTEEARMSSLNARLSKQTACVTVLLNCLYDLL
                     CVASASNATARKVQNTAEPVHPPHSTKSYGREEDVLGGEAQARRPSLVARELLVDALN
                     LQSPTGEAALLIAVRHNNVAVALRLLKLGAQPACMDRVTRLLSLELACANRCTSIAEA
                     LLQSHNGGGAVYAKSPVLLNHAGIATALCWCAINNMPAIMQRLLECDGIDAESGFEGS
                     SPLHLAIAFGSEAAALTLLNGTQPRKTATSSARKGRGGGAEAPPAALVAAATAAPDTE
                     KASLAAKHVNCGTGQRGAAAPSASTARLTEAVSAAETHKKPFMDVSILHERTHCTPLH
                     LACERGQLRIIRTLLYSWHAQLNIAAAYTNYTPLLTAVANGQEEAALRILEYSKDELR
                     RGRAVLDLCAIDQRGDTALHLAAGRGLNLVVEYMLVQFSEEEVARLVALHPTLRASPA
                     YQTATCIVPLHAVNKQGKTALLVAVQYDQADTAELLVSMLIDSAETLEVGGAAAAFGG
                     DGVPKSPTAATDAGEASCNTSAAAAALQPSPIGGPLIEGTCMALHQAHRKHLDSVVQL
                     MLSAPPSLFPCTAAFCTSVQLYKQQQADVRRSGALLRSESCDGDVRPACVADASTDPV
                     LASERNENALQRSPAMAQDRGSFVRLLLTRAAGPTIAPNDALRVLLRGFALPELCVYL
                     SEVAAESAVLGVQQGTAMADAELLIGYLQEHAGSVVAPTRAVVFCRDVWLCLQRWMSN
                     EASTERERAAVSRTHHAFSSKTTDSTYPQLSVSMEKGGEHRQKQHQQSEFEAAPMGWL
                     CRMLLVPKSDVGSRAHGKTAQPTLALPASAAQEGEHYRHALEVTLHRKTLSLEVARMI
                     RLYGRSHGGARAIEEIKSIVAAYVRAHINEPAAHVRLATSVTLSSSSQHSSFSARTRS
                     MAQSFRDAVEQHATWNRDGTVDLDAAEREFPDRNAVAVIGNEPLFTTPMGFTVLQLAA
                     TLGLPKVVAFLVDTYNLSPLYAPAQGMHTCTAQSTTPPPQASLSKEGTRKEEAARVRN
                     VVTHTVRAVVGAASSCAGRGEYGGANGSAGKSRADDGLWICWTPYRLAVRSGNLHIVK
                     TLLLTGSGAAPAVAEIDPHELCDTSTLAQFSHSGKHVEDSVAVGGAGATAPTATGPTA
                     SLVDYKEPAWLDPYQRTALQESIVVATTCGSGASGSNSRVDSLTFTASAGSSSSSAAT
                     KSAPSLSEALALVHLLLKHGAQPNGLFDSTGSDAWLLAMAGSGAADLPITHYSYAANC
                     KRRSCSVGSEASLSLLSLTGASAPATPSLALIRTTAGEAAGQRCVDLLLRFRAPLLGC
                     APATLRRADTHLEGRRLDGPQESAESECFNEQLLRHPRRLLHQWRHLPCMRLAPTRAA
                     AAGFAQRDRRAAGTAGNVHDGSGIDEGNAAAGEDDDGAAAHRYSVFEQADALCARYEK
                     MQQTLHPSAAMAIPRGGGGVEPCTSPQPATALATKVSFASLLTITSAEEVTRLPSAVD
                     PGGAVTPNRRVLTGGSVSRRDSVAGRETGTSPPTPSFSAESLKKQLIAALRICYRVVL
                     LYTCVEYTPLQLLRLVRAFGAAAIPVSAQHPLSGDSVATRLLRKTHARLLAWTSGSGG
                     SGDGSTGNTPHGVLGSDAASIMMRDVDEMSELPMSVLKEPPCTSDPAADAETRALVDT
                     CLALVHMLCDAALRLPSPPSAPHSHAAATAAGQALRSVLFQPSCDGETALSLAARIAH
                     APLISVLVQSGAAVSSASHNRSRGGDESWCCSRTACSMPRRGDGSDTEAGGEDGVGVY
                     DVSGIPDTSNYSLSTNLADVVVRVLLATRVYYPEHEISTVRALLTHMPNEPARRAFLR
                     GVYPNIHPLPALQLAMDNVNIASDFLTSPDCMNALWTNLLYAHFTGQLDTAVRTTAKA
                     WSELLRVVLPGAPAVPIYLVMCAAVREEVSAEELKASHSGVHAQSPQVTLSPPPSLAS
                     SSRSPSMVKKRSKERSVPSAISNWSHVVRRTNLFLQLMAMSAAEALMSKSSKPASHVS
                     ADARTPPSTAATASGSGQRTKNTSSPMHEVTQKGSFAALTDVGEPPSHGLSGTLLWDT
                     IELAVRYDNKDMLRHLLQLRLPDIVLKHIGNIQSQQQALSSTGTFGGTYSSMGVSARA
                     MEAVSTTILGSYPSFAGVSTTSQATLVLERLQRLLWCEALQERHVDLLAVAAGSVATL
                     RFLYTSAPPEVRAQMAPMRYDRVDVKSGMPEGVSPAPDVVAPAGAEELLGSFQRLRKS
                     SSARVGSGVMSPLPQVFRFSSKVETNARAVHQLTKAPFSASAASTPETPTSPVSPAAK
                     RASLALDVDIVETPDERSLTLPLTGAPLLQPKASEDKEEESAAAVVDAELRFMESCVQ
                     NGRRRLAPGEERRRCVTAVTWGLGAAACAVKLPLAQSSARAVSAATADTAEAATTPST
                     RVEVQPRRTLALPQLPRPPAQRRITLDGKIGDVGPAKDSHKAIADAETTAARQVVQRR
                     GRATTSLPTKASAAAKEASGLAPSSPTPPAVVEPEPVYFMYLQLDWALHSTRLLRSPR
                     PSSATLETIMFLLDQRVALAVPVLDLFLAGTVAPSSTAAAAPQQHSGNADAQQEFALD
                     LRYQTRAHRDTLLHLLVLHDQCQLAEYYLEYCYFWFVSNGLDPEPVSGRPGRFPIDQP
                     PESPDGDSSEDDLNDDDANLRSGVGYIGHDKQKRRTRLRQQLRHRSRGSSSGYAGTVP
                     REFLRCMLRVNAHGLTAFDYAHTPAMLQLLEWYGCVPPTYRPNPHAFRRVVFLNRGGH
                     GDMREAYTFSDTMDDYDSDQAADWRQSASVRPSMMVRRKREVLRFLPVPRLVLATDNF
                     VALLDPTGTELASTVGSVAATQARAAASGTADGRRRNGEDDVDESLAKDEVLVSTRTQ
                     PLQLSDHCIDAMISTERRQLQASGRRHHQERARALLFEQVAAQSQVLVASRGGKGGGA
                     AESVRDGTLPYLTRAVTAHRRQQWELQRHPPCSEVTLWHNALEAQRLSGSAFTATSSR
                     RQLKRRAKGGARGSDGVGAGILPILLSEEVSLLHLGLCSFEDELVRLYGELHTASASA
                     SAAGNEGTSGAARAHCTGSKGVGAIGDGDNAASVLSAYSRLLLPPSVTDKPATHRQQD
                     REEVKRSSGMMSGDVPPETDNPNSSPGTKASRTGRTVLPRVLFPGESIGGALSQAQQG
                     SQLSSAPAANAFVATSQDIRSCGRAPALPPRLSQMDVVFLLECQQFVVYPLSMPSTGN
                     AVEVVNDGGDDTYDESSKPRSSARGGGGLSVSTGNAGRAASNEEGNVASPRLSLGKGA
                     VSVSELPAVIERCTGGSIGRGEQRVKGAGRGAPRQRAPSPATTTRDTAGLSPASPHRS
                     TARREHGGRMRDAPPSDLPLLRSLLARKAADDLSSELIDVSAHRHEAALLVSLTPMLL
                     SGISGDGAAGVRVSAAATMKNLAVKLMQTRWKQFGSRPIISGTNTDAATTATEAVALL
                     NVPPFTLTDDPALCPSRAPFSAAPAADERGSVASTTALGAAAARVPTVIAAQLEEWVA
                     RRWPLQGQAPPSPKPRRGAGGRADTASSRSPPTKPITAGGQENEDENTQDRKGVDADG
                     YDDESAAPSVLDRIEPVGGVATAAQQVLMRALLKRFTAATGAQLSEQMGLVITPNYDV
                     AEVGDTAAALRDIEAKIAAPAAPRKKRR"
     gene            <493067..>495529
                     /locus_tag="LMJF_19_1140"
                     /db_xref="GeneID:5651219"
     mRNA            <493067..>495529
                     /locus_tag="LMJF_19_1140"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682645.2"
                     /db_xref="GeneID:5651219"
     CDS             493067..495529
                     /locus_tag="LMJF_19_1140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682697.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651219"
                     /db_xref="UniProtKB/TrEMBL:Q4QDA1"
                     /translation="MELQTQPRFCPPRPRPYAASLVWMCLACGQLAPCEAASRYPMDN
                     VDGLDNSLQGTSSAMNAMPGGFDIVTTLSDCEAATPANSSSPPNTAQHLFGPSQCGGV
                     TGSTAAAAASSASSPATSTPPRQEQRHSCVNNASDSYLLQAASSSHRQSEQQQQQRRR
                     PSSVSWRVTGATTEMIHPDSVGSASERRKWREGELVSSEASNLCAGEKALGDDETLVC
                     EGISSSHGRRAPTTVTTPRMPQLTTSLGSTSNESSTLAVTPCEPAVAAPPQLSAASSS
                     LWRDAGVHGVQNLLSSGARSRQQEDDATCSLTVLLMEEHLMGSREMRFCRCCGEVRCA
                     EIRKVAERLPSPLSAQAAHKVSYADEEGDEVVAAAAQATEESEHEHWKAVLRHSCRSA
                     AIRRDGGAEAVYGPFTSPALYSGNGSQPLGFSAPAAENGCKPPETAQAEARKEIPSVH
                     LAVALSLARLLSKAKAMAVAALGSLHPLSPALPKRYFSIHGSEHGDKAAIRGYGNGVL
                     ASDSALRSARSILRPPPRDQEGCRPSNPLYNPREGMGTSSDHWKLLSASTATSRTAPL
                     ACASVEECPLQCLASLPGATGGGAAEDLDGISMESSAQPSWAFTAPDEEETCRAEDDD
                     EGFVIQHQRGGVQSDEDASAGGAEDTHTCVRRLYGDSTVTSNIMGTTAAAAAPRMMRA
                     SKDKWNSISVSEALWRLVLPSFSAPFLSSTSMPSTATAAARATAVDRAFSAVGGRPLE
                     SLMDWIASAPRRGAVESTASSAVVTGTRPYRGFRGDVEEAVRQLDAAQLEVAKLRLQQ
                     VLAAVMAEQLRREGQSEGEYST"
     gene            <497252..>505222
                     /locus_tag="LMJF_19_1150"
                     /db_xref="GeneID:5651220"
     mRNA            <497252..>505222
                     /locus_tag="LMJF_19_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682646.1"
                     /db_xref="GeneID:5651220"
     CDS             497252..505222
                     /locus_tag="LMJF_19_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682698.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651220"
                     /db_xref="UniProtKB/TrEMBL:Q4QDA0"
                     /translation="MAGLQSENISINSTRLPEQSASDKDICVFCFRRATPSSSDPHAP
                     LFPFFSLVDCRHYACQPCALVHCDNAGRHIFCPKCHCVSRLAQSGRRRTRSAAAATDA
                     DADRVSIDDGVSSTRSRRTRTGTTPHRSALKGKSGTSKRRASSVQFPANPTTSIVPAD
                     GVSVASGAAAVPSEGDNAGEQHQQRRALSPLTQEAVDALPLDPMEARRRRAREQQQQQ
                     QQLRAAEAAAKAEKAVGLYAITAAPPPKVAPPPPSASAASGTATSEGFKKAKDRSRSQ
                     PVPKLPHTILEPKEEYPVPPPLVLHTVEEEEAHAPAATGDSDRDAEPVLPAAAAGATA
                     AVTAEEDVKAEKSASALASTSKTSVTPRQMEDEVEAAMAASADKSQTTGVLPPLTDPA
                     EELARPHQLLDDCENNEAEERGVVGDLEAHERAALMQRMEEEDTAIHARRGLVLEFDS
                     TPILPQKQQPTLHNQHSHHDNTGSISLVDFSDQVSVTSDDELSQRVSEYKSASRSDNT
                     SRRRRRTSVHGASELRAQPRESTAGEPDARVEKGGQAAPARTPGDALSSAAKSVAGSG
                     SAENTLSPMTAARQGRVLASEEVDDGGKPIATRAAVAEADAKAEAEAIRTAEEARALA
                     EEQERARQRQLQREAAEEAAEQKRQQQRQEEEVVRQRQQHEERAAFACQALQDREGLA
                     REALEQAEAAVREHYERGADEWLTAALPHELEAQRLVRVAAERRRQQEQQQAQLAAEE
                     GLDRDEVEEAESNAWSWLLSGARVDRVVAATEEGDRVQREYEELRFERLQLQLREDTE
                     ELVHEEAHGRASFIEYEAATRSFLQSHHAVQRQAVAEGEWRQEAEFFKKAAARREAVL
                     RQRFQWELDELDAEEVSGRTMLREVEREERRTAHLVFLQTLASIRRKEVLAQHAAAAA
                     NEPGGTSVLSEAPTMIAAQAHRRAQQRQADPAVPMMLEEDGDDDVDDAADMAGTATPP
                     QFCTPLITAKELSELRAREASYAAELQAALERLREAERRVAEEAAIRVQAEQERQAAH
                     AESKRLLREAEQRAEQRIREARDAAEQLLQAQLADLRDEAVRRAEHAAVMQALAEEEQ
                     RAVLEAKLQAAQRQLDEAQQRAQEEVRRARADAAEMAATDAARAALETQRRDEEWQER
                     CRAERLLRLAEQEREKEEAVRRLAEIEARAAEAVRLAREEAARTAAEAQERLAEMERR
                     QQAREAEVQSAAQRVRSARDSLREFDSSTQSSRYATPFRAVLPGQRPPTSSSSYRVPS
                     LVAASSAHATHTAGAVAAEASVLTPLQTPPLVPSSSRTSSAMRRRPSAQSPTPRVAAR
                     VPAAGAAASSAPSDATPPKVIISSQHTPLSSAVAPGLGGSGAAAPPSSASATGATSLA
                     ALDPANIIRAAIRSAVQEIVEAQRRTQTLQDRAEQNIELSERRYHRRESDRLRAARDV
                     AAMESSYAASEADENEERHQRWWTWSQQPHQRTRQRQPVRGYERNSCVASSRVSEERL
                     RPVRSSRGDYAQEASESPWTRSSSSPASRLSPTGAPLSTVSPAAAARSVSSNTLLSTS
                     SVYFDNRYQPSAAALGAAHQRYRRNDCDYTAIQQQQQQQRLASFAPRSSASRILFAPR
                     AAHQAREAWAATDGECGYAQRMHVGVGAHAYSRIASAQQQRYATGVAQPPPRQPLLET
                     VGVTAAIPSVAHAYNEPEPLPLAPAAMEYSPPPRRSTTRAAAEVVPQQQCQPMGAGAN
                     VDSSGGIGALPEPSRMCPRCYRTDTTSPCWRCGEMICRHCGLPPGSARKLCCTAHHRA
                     QLREFTRCKAYESGKDATAVRAGKVPSPPPPQQPQQQQQQQRLRGEQQVQTSFASSTA
                     SARSHDPGHFTDEPAARLDVGTSPLTSISPPSMISPSAYRAPEQRQLQQQQPQAQPHY
                     PSGYQAFTMAGPAAPSEQPTYSPGYHSAAAAYPYAYLHPTPQPHQLPTHQLPFYADSE
                     RPHLMPQPLGPYVQPLGQPQPYAPFGYSVRAATAALGSAATGAAFAAPMTVSEAQRQQ
                     GTTAVAAEARAAHELPPPASRAAAFSAVVMPHASPAGLTQSPPPPSALPPSQQEEASE
                     VMGLCAAALGGAMVETAAAVDSTPDAQVQQRPPTSTRVNDDRTNAEAKQPVAAENHTL
                     PNATVAAAVAGSAAADASLPGTAPEKQGGTTAPVDAGSTPDGGAAAENDGDGTSAATT
                     GATAAAVLEEPKTERKKTFPAFFVSLGDGDDAAEPRRPKPPTPRNSVPSHLVPPPPPP
                     PPRKQQRRTLPSGMLLTSQNRSGWQSAHHQHQSRKLSPLQAHEMNCERNSRKSVSPRC
                     GFGAQRRQRHTSPSPYEQVPKASRARDGPRKTPSHPSSKQRQRQPAHADGTATSMTKS
                     IKSYIKSLSPMVVVDESGTPVVYEDVRKVELSNPWMQQQQQLPQEWSATATPAVHDIY
                     LSSGGIRSVGAEAERNRPELSHDHSKVGRYYVDAPSQPHDSSPQQHQHQRSSHSDSYY
                     PYFTSSGATSETQSQPPQQQLQQHLYAPPQSHIPTHISYAAPFVDRRVPTLAELEKRL
                     QQLRIVDEHEAAQYHRRQAQHAHQQQQQRIHVLLHSPGAVAVGGNTGAFVTASSWATR
                     ERAQPQQRRHSSATGRHPQQRTVSPPWRTDLNSSPVRPRWDISQPRSPIYHPAPGAIT
                     GN"
     gene            <506941..>508050
                     /locus_tag="LMJF_19_1160"
                     /db_xref="GeneID:5651221"
     mRNA            <506941..>508050
                     /locus_tag="LMJF_19_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682647.1"
                     /db_xref="GeneID:5651221"
     CDS             506941..508050
                     /locus_tag="LMJF_19_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682699.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651221"
                     /db_xref="UniProtKB/TrEMBL:Q4QD99"
                     /translation="MTALITKQRYNWMGYDGVESAVCDTALLRSDGGPANNYNYMHRQ
                     QVIMEVKERLYRIKRDLGLIPEEELRAEERAIQRRRMEKKRREEEERIRKEAEEAARA
                     EEMERRHLELEEAEERASAEEVATQASAEHKHYMNDSDEDSDEENGIDDEQSASLVAM
                     LRTQEEIDSAIAGFTKGTRMLLASSGNGYVSYLDGSVHFTIAKVESHNASNREKVMQA
                     LAGTNVAMPTAEEYSLEEVRQAMHDRDTARKKLDALRALQDPTYTARIRSAEKDTYGT
                     PVQQLMEEDGDMSALVANCEDAKRFAESVRKAYNSRAAASAHALACALCTPPFTAEQE
                     STSEAQAPAGKMANAEDGVSQPTGANSPSSSTSAQ"
     gene            <510943..>513729
                     /locus_tag="LMJF_19_1170"
                     /db_xref="GeneID:5651222"
     mRNA            <510943..>513729
                     /locus_tag="LMJF_19_1170"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682648.1"
                     /db_xref="GeneID:5651222"
     CDS             510943..513729
                     /locus_tag="LMJF_19_1170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682700.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651222"
                     /db_xref="UniProtKB/TrEMBL:Q4QD98"
                     /translation="MQPSSPLAGLSLGPQQLANRRQIVPLLSSDAVVPQPSAGTPGTV
                     PRKAAYTANLEAQVRVLEQEVHLLRAGLEQNEKLRHASATAAPQLQRSSSSKRVHFGP
                     SSVVVLSQPTRSTSASSTVATEVDGRPRLAFGQRVSATRSRIATHGPPHADTLQSRRM
                     ASLGKPARTSTRSASVPSSSPAPATSTTSVDLSPVPASLRGGNASGIPLQGAATGGTL
                     VTPVTADTQPPASSLAGPSSASPAAATVWASTDASLLWPRAAAAATGTLASASDLSRY
                     PFRTATTSSPAAAPTPVIPEPPVTSSTQVVSTAASPIVVAMSSEGHPLTSLPQPAMPA
                     SGPATEATPSPAADSALVAANPLVRATAPPPSVSATATPAGTSASSAASSSAAGLATV
                     AQLETEILSLRDALAQREALLHRVLLELHDRNGSGGAHRQSSPARGETPPRHRQGTDA
                     AVAAPGESERQQSRRAMRLLTEELFAVQTQLSHARASHQLVVAELHTCRQQAHRAPPP
                     QQQRAAAAAPEKTSPAGTSQPSSGPLQAQLDVALKKLQAWEDWYATSATAAGDEDADA
                     TAGNSNAIPSAKDAFSSSRQQPPSTTNTTEQAAGAAAATKGHHSRKGSLEKEKRAHKT
                     TAPGWCPHCGFALPAAPSVLNTSGRVGSGVVPCGVELPGLAPASAISDFPAHYASLSS
                     PSALLPQRPPAAAPSAPCVSAYALDSVMSHHLTSQFGGSGVAANGSAGAVPEAANKVS
                     GGAATPPPPPPETASSPPSPAQATDTKGKSRSAPVSAQAHAAAAQQNSRTGACGASSM
                     WAVPISGTSIAGVGGVSGGARERTMQTAFMGGRAASDPSLSPYCDRLDHAQQQAYRAQ
                     RYVAQLAREAAVRELAEVERQVAEQRLSFWKHHHSSAHDLSAASPTPPSLAPCSSTPD
                     GPHSAAVGKQEVVE"
     gene            <515264..>520423
                     /locus_tag="LMJF_19_1180"
                     /db_xref="GeneID:5651223"
     mRNA            <515264..>520423
                     /locus_tag="LMJF_19_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682649.1"
                     /db_xref="GeneID:5651223"
     CDS             515264..520423
                     /locus_tag="LMJF_19_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682701.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651223"
                     /db_xref="UniProtKB/TrEMBL:Q4QD97"
                     /translation="MSDGRSFWFSGLLRHDNHERSELRGGDHSDSSDNSDRAAEVFYD
                     HRSGLLQHDPTDPSTARSGDGLAHQSLRLIPGDQQQQQQQHQRRPPTKQVPSASLTSS
                     LDDARKGSVDSFPASTFASATPGATSSALVGTVDETVVTMDHAVRVPSALRGAGRRTM
                     FDVLIDVAARQRRQEQRQARPQEWAEGKNLASKPSATTRDAQVLATHPSGTAASSLAV
                     ASSAREVTYQMLFPRTATAAAAARMSSSGPTTSSPAVEPPSPSGSEHIHRYTSPVSHR
                     SPPPSSPPPPERAKPDRRLRHLLPAHLRGCPAALQSADENSQRHQLQTARQHEAKCPP
                     ARHADHRAGVSALDTSDISSISSCSDDDTTKPDTRHPPPHLGTRRNAAESWAAASTSH
                     PQVPPAVARPTVLSRLIDGDDEELVRLGHHREARGRGEPERPQGVAKEPKTKWALLEH
                     VLMGTVGAAASSSHAGRPKCAGDRHRRRRSRHHRVGRITTSGSSERSATHSRTTEASA
                     SDPDSTSSRGEDAGHDGGGVVDLRRDLDDEVPQWVRQHEAARERLAQLQQQQQQFSWA
                     SPTFSNAHMFATARAAAADKARALVATTAVASRSFLGKPRIFCPSSMAPRTASAASYA
                     ASGLVGSGDAWSTVSDAGRGRHDTRSALTAAAIAAGVPRSLLAVWKEGKRLLKQRSSN
                     ATAVAVVEYLWQCFQAWKPCGLRLLHQRRSGFCASDAVGAAGGPIEDISGTSSDDNGG
                     HASAVESKAARKPRSVGKQASPQRRSRGTTGGGTDATRGASAQNKDEGCAGDAAAAVA
                     AAEADGGSDEGIELQMKVHYMESAFNVVAVHGELTYASERACARLGLAYPLPPSPPCW
                     SPRVSGRAEDAETTPAGQQRRWTFLVPEPALTQVPVLLQEHLYLAPPYTVLREMQTVL
                     SSYNFTTDALLRQHAAEEEAAQEERQRRRALDASNAAGVAAQKANASSTTAAVADAVL
                     EGRMLDRGDGESGGRQRGVSPTRSGSLRNGAAASAPTRWWAALEGNDETSAVREAASI
                     HARAPADHADAPVTNRSPTSLHREFGGEPVNLDPTRLGRATPLKHLQRRQWPVGDEED
                     THLRIQSADSVEGHTPTAVRQCGSGCVGASPEPHQPPVSRFPPPPLPPPLRLCDAGNG
                     CDAVNAEAQWPQGVPPEQPTVSPSYVRASTASVNSISIDGFYDPLAMPALPTTGAKRG
                     IAAACGTNERRGDCGGSGTNGLATATADVTMALTRESGHGADREIVPEDALERGLAAG
                     PRELPIPPQMTARPNNSLRSPGAVELAANLFGGVVGEDAGARGGNALANEMSTVTAAE
                     AVSANPLMDHRVGGGFPRGPTDDWGIPVEVLFALSGGGGPWRERSEQPVRHTRRHGDA
                     EIGSAREEDDDDGAPVAQQGLADARSWAITSGRFAQEPVHTHKRHRHETRTSDSAFEI
                     TARGEASSALDTAAASQLASQRIPPSATLSLPTSRLRSASAASSLVSSAAPSSSSPSS
                     LSEPEDGDDDGVKSSGTAHAARKPCWKVNAKGAVRWPRHGTRRSGRDGVFVTRQQQQQ
                     QQERWIRELWGRGKQNDEPSVLPAAPSTVSAPAHAPAGSSPYSLRQQQASQSQRQSMM
                     GTSKPLSSAVDASISALRAESASARAAPITSETGGNAAMNSAPPSPPLPDEDSAAMAS
                     NADPLPSLRSLEAIVRGVPAVSVLHHAEDADASTATAGFFALEDVYLSDAD"
     gene            <521395..>521787
                     /locus_tag="LMJF_19_1190"
                     /db_xref="GeneID:5651224"
     mRNA            <521395..>521787
                     /locus_tag="LMJF_19_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682650.1"
                     /db_xref="GeneID:5651224"
     CDS             521395..521787
                     /locus_tag="LMJF_19_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682702.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651224"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="InterPro:IPR010625"
                     /db_xref="UniProtKB/TrEMBL:Q4QD96"
                     /translation="MANGVTANSMRVTAKPPDLGSFPLDHYRECKSEIEKYYACLKEN
                     NYMTPMCRGPVREYLECRMDRGLMKKTDVKSFGIPETEFVPTKQHRIDLKEQWLRQKM
                     NQIGVVGVENYIRDDLDTPDGYEKEKGA"
     gene            <523371..>524549
                     /locus_tag="LMJF_19_1200"
                     /db_xref="GeneID:5651225"
     mRNA            <523371..>524549
                     /locus_tag="LMJF_19_1200"
                     /product="putative actin-related protein 2"
                     /transcript_id="XM_001682651.1"
                     /db_xref="GeneID:5651225"
     CDS             523371..524549
                     /locus_tag="LMJF_19_1200"
                     /codon_start=1
                     /product="putative actin-related protein 2"
                     /protein_id="XP_001682703.1"
                     /db_xref="GeneID:5651225"
                     /db_xref="GOA:Q4QD95"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027306"
                     /db_xref="UniProtKB/TrEMBL:Q4QD95"
                     /translation="MHLHRAQPLEKKALCGDDLVATGALAMVEQTHPMRNGVIHNMDA
                     MQEIWDYALCERLPALVETSGGGTARWRYEDGLEWLQERPLLLSEPPNMSLRQRCDLL
                     ELFFEKYGLSAIQTVQQGILSLFANGTERGVVVECGEGLSHCTPVFDGFVLATAQRVV
                     GVAGRAVTERLGQVLRHQQPHRRYQRRVPTGSGTSAMSHASWLFHDMNTLQQIKERYC
                     FVARQKNGLEDRLTRETSALHRDCVLPDGTSCRLGPERFAAPEVLFNTQEIGHESDGI
                     TTALWKSIEAADIDVRAALYENIILSGGSTLLPGFGERLQQEMKSFYLTEKLNGDPAR
                     MAWCPIRVKEPQRRQHMVYMGGALLAELSQDQPERWLSRSAYGEGGTSAIIARYHATD
                     "
     gene            <525562..>526191
                     /locus_tag="LMJF_19_1210"
                     /db_xref="GeneID:5651226"
     mRNA            <525562..>526191
                     /locus_tag="LMJF_19_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682652.1"
                     /db_xref="GeneID:5651226"
     CDS             525562..526191
                     /locus_tag="LMJF_19_1210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682704.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651226"
                     /db_xref="GOA:Q4QD94"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR006984"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q4QD94"
                     /translation="MGKVKKQANHAIKKILMKEKSLAMKKKREAESYHETPESNTTTQ
                     ATKDYAAVLFRKALVTQAAPTRTAHFLSYNTALGPPYRIWLDTNFINFSMQNKIDIVQ
                     GLMDCLLAKVIPCICDCVFAELEKLGKKFRIALKLARDKRFERLTCDSKYADDCVVRT
                     VTQHPIYIVATCDQELKRRLRKVPGVPIMYIAKHRYTIERLPEAYGAPE"
     gene            <527356..>528054
                     /locus_tag="LMJF_19_1220"
                     /db_xref="GeneID:5651227"
     mRNA            <527356..>528054
                     /locus_tag="LMJF_19_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682653.1"
                     /db_xref="GeneID:5651227"
     CDS             527356..528054
                     /locus_tag="LMJF_19_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682705.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651227"
                     /db_xref="UniProtKB/TrEMBL:Q4QD93"
                     /translation="MNLDDPDATRRRIEEDLDRLASDEKKDTTAYLHSLLNLALSHYQ
                     RGDFISARDMADYTHQKALVHNSKSSLIYFTATTCAHCAEALAKEYEAHLQRKDEQSH
                     VSATLTPEPSVVFSARRAIKKLRADAERYRGIAHRVYHRPDMAFMRGSGGGGSGRWRS
                     SARHAEGRDTRHTWADDSSNNGVDEDYIPHMYGPRWQDRRKRPEHAEMKHYYKHQCGT
                     SPSSRGKTQWNVPK"
     gene            <530381..>531406
                     /locus_tag="LMJF_19_1230"
                     /db_xref="GeneID:5651228"
     mRNA            <530381..>531406
                     /locus_tag="LMJF_19_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682654.1"
                     /db_xref="GeneID:5651228"
     CDS             530381..531406
                     /locus_tag="LMJF_19_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682706.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651228"
                     /db_xref="UniProtKB/TrEMBL:Q4QD92"
                     /translation="MLYGGSRVQYLVQPPFTLHKIRSENLPPPSLYAERHDLGLEMQL
                     PRDMHVYNSINMAIQRQVGGDSSTLDGEQQQLQGGHADGFDMGAFFTEQHHPERHHNS
                     SLPYAKHDTNNVLAMRLFPVNVGVRARTEAIRIRTDDCLQRLRDADLCAKMRLPLEHP
                     LPLSRRSQYAAIHRVRQERCYDAPTEAAGERAAAAAEEASRTAHLRGAAAHPPPSELS
                     IVTRPVDRLGSHSGSSAAACTADADHLSFPVHPFAAAAVSSGCHSARSGSAARLASQR
                     WLPLQTLKPMGHNWSAATRSSGVRGPHMQLMQERLDQKGFGWKRKSRSLWQQDVATAG
                     FRPHRYF"
     gene            <533670..>539393
                     /locus_tag="LMJF_19_1240"
                     /db_xref="GeneID:5651229"
     mRNA            <533670..>539393
                     /locus_tag="LMJF_19_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682655.1"
                     /db_xref="GeneID:5651229"
     CDS             533670..539393
                     /locus_tag="LMJF_19_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682707.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651229"
                     /db_xref="UniProtKB/TrEMBL:Q4QD91"
                     /translation="MDGGCDATLLLSPHHNHHHTPHAHFLHSFSSLCLRTARGYIDIE
                     SLSEYLHIDTHIHTLSSTRACVWRWWSSRSPRAAPCLPPPSTHTHTPTPTRHSYTELV
                     LMREGGTRAMTDSRHYILRLWSLAEDMVTQSGKPLQAFLLLHHVLTKPPPSLRRASGA
                     TTDKPSINSSGVGASTATLPTATTSEAALPLHVTAFDAEWKCEELVTRLRAAEYLLLV
                     DVPAARTEVSSTSTAVPASSPPRTLSCTAGLEALELAEQVLAPVFATTSLSVSTDTVP
                     GAAPPPPYQLASSTASWWHQKCRVSNDSAGGGDKSRGSCSASYSLDDVLREVADVSRS
                     SASAAARSSSASLWASVSGTDAGVQSRVASMYFLNHATVTALAWPLSSFTLAWPMRET
                     AVDGADRSHGGSGDGEQHLLFGPASDTITIAVSLVVRAHVLQAFICHRRAQHNRALQC
                     LAEARQWIAQQFTDAARARTVRLLWEDLQERWTPPSPPPPPPPQQQQQSSRTSSSSSA
                     TAISAVQLPPLPAFYRLIERLITEEGRACAAMVQVEECKVHYAILQACGSLPPPPPLP
                     VRTSSSAVTTTFADASAQMQAHTVDLRLHYRRYQESLQLLHVLSRAYMTVVRWVEEEA
                     QGDVMTATAAEAPPPSGSVDVPEQGVTWREALRCVRSRLSPFCLCALQYTCNRATPVA
                     PPDFATGTAATTTTADVSPCYALGFDVRLAAEVLGLYHCLSYVYLLYQQSAAASTLQP
                     LSAKHRESLSIVDLIARGAGGGGGGAQQPCNVSATEERAKGRHASRGDGTFEAAKEEV
                     EFLRRYRSDPAYVALFGDHRIRPPARQALSSLDAARDTDAADDADVLSITCDLVHRAV
                     EYAKINAFVFGQWRLGDAAVTATLRAPSATSANVKGEKRLKTESAHNDETGAARDQCA
                     GVQAAPLLRWGAPKDAAAGTAPATAHEAALLWCLVELGLRDNYPFAIRFQRELSGALS
                     RVTDVTYASGEGAADRVTSPPQLPQEAAEGEVVVGGALPTCRRPEGASLPGIRKHSRS
                     PSPSSMLLEHRASHRAASHLQPPPSCNWLFPGFRRALQLYLELVTVLMRSAATMHVTS
                     STAATGAEELQSAAAFSSTATSSTAPSIPILRLGLHHAEQLMAQVLFTVDAEMLHLSG
                     NTWGIASGAGAREGGCTRVTSATDYRNGNGKGTSSGDVSPSHLRHHFLLADQLQCSAP
                     AQLRGLVQIKAAALVTMARHHLTQLSLVRAVHYLREGQQFARVFHRQAKWTLVPEMHV
                     LLACLATCMSLRRLPDLPEPAVKKGRNSEGRGHSVSSGDGEAATDVALGTAHDALCAS
                     AQGWISAERATSIHAGSDDGAAPHGPHSLSGHHSSHVGNGTGAAAFAVLPREESTVAQ
                     DVGLPYLHLLAAERAACTTLHSPPSLSLLLYILKAWTVFHLVTAGEELVWSDVGCNVS
                     SLLTTPPHAPTPPPPPQQQQQSTRQMNGSPSMLAAVSRSQALKPASPSPPFLPLPSPS
                     HATTTLNTTVEDQQRRVARLDSLTSTPTSTPTLRSRHATVPTEMHRIQLEPAIMSAAT
                     ARAAVQVVKGEDNDDEGGGEGRAATGVAYVNAKGASDGSDDGKATHSPQNRGSSGVDK
                     SSAVKLENGIGGTHARGIYAHFRGASAMAATASCPAGAHVRALPHTQRHRAGDVLQRM
                     MAVLLDHYETHGVYAAPITAAAPSLSTEAEGATLQRVPAAAWTPQNVVLFRLLRGAVM
                     LCEDRDEPAAARELKEATHFAKRHLGVLHPYVADGLALLASAYASLDVDAVPSGDSHT
                     HGEPSSSATSPSPQQVTGGAARTRKVAVQVAMRCSCMALASLYATSAANGSDSVDAAG
                     TTTAQQPQQQTTPFSTIGARLREWWGSQVLHGLCGSSSGGYNANAVQQLRLLFGWLPG
                     SAEYCFS"
     gene            <540594..>541979
                     /locus_tag="LMJF_19_1250"
                     /db_xref="GeneID:5651230"
     mRNA            <540594..>541979
                     /locus_tag="LMJF_19_1250"
                     /product="putative peroxisome assembly protein"
                     /transcript_id="XM_001682656.1"
                     /db_xref="GeneID:5651230"
     CDS             540594..541979
                     /locus_tag="LMJF_19_1250"
                     /codon_start=1
                     /product="putative peroxisome assembly protein"
                     /protein_id="XP_001682708.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651230"
                     /db_xref="GOA:Q4QD90"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017375"
                     /db_xref="UniProtKB/TrEMBL:Q4QD90"
                     /translation="MFESNLLSQINTASPLPTVVEVQFTTSINQSLYKAFQFAHTLLA
                     EKSDRAAVLLPWSDEIYLAVSGMLERLMLEHADTTFSEMIFALRRAEVDGPLAAAPPL
                     SSSSAAASGPSSPGRRPGARSRYLRWLLLGPPPVTTPEERAMNFINDGVSSQLRVHAS
                     APADTAVAAIASPDMATPTPLMDAVATDAAEAVGNAAEAAALSQLKSVELLKAEHAPY
                     GYLRFKTLSRRNKVISLLLLTLKPYLERKAEQWYVRNTDTSVDAVAMRNAYAYRYPHR
                     AALLHFLAKYVYPIYHVMKQGSRFLYMMCFLLEMTPYTSPLHRVFGIALRRSTLEDSL
                     ATGPRAQRALLVARVVLILVFCGFRLLDFTRNADGASSPRQIREEGLPIPPPPVLGSD
                     VPLPEDRSSLPKAGECPVCRRHVTNAAVCLTSGIVGCYPCLQGYVREQRTCPATHQSM
                     GVEQIRRVFEC"
     gene            <543273..>543788
                     /locus_tag="LMJF_19_1260"
                     /db_xref="GeneID:5651231"
     mRNA            <543273..>543788
                     /locus_tag="LMJF_19_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682657.1"
                     /db_xref="GeneID:5651231"
     CDS             543273..543788
                     /locus_tag="LMJF_19_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682709.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651231"
                     /db_xref="UniProtKB/TrEMBL:Q4QD89"
                     /translation="MSAMGGIKGGVGSFLLRRTAAKSIRQKHFTGPQFYKRKTFNFPI
                     GHHQLHRRVAPALQTGSPTHQREHQRYAHLPGDARTRPSEDFTFSRSPSPRVSGRSRQ
                     RVDKAMYAWAKRGSLQLYQMGGKRETFACYRCGYPVRSALVAIKDDNWDYRMCYNCYT
                     KTVDTGMERNT"
     gene            <544444..>545127
                     /locus_tag="LMJF_19_1270"
                     /db_xref="GeneID:5651232"
     mRNA            <544444..>545127
                     /locus_tag="LMJF_19_1270"
                     /product="putative RNA binding protein"
                     /transcript_id="XM_001682658.1"
                     /db_xref="GeneID:5651232"
     CDS             544444..545127
                     /locus_tag="LMJF_19_1270"
                     /codon_start=1
                     /product="putative RNA binding protein"
                     /protein_id="XP_001682710.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651232"
                     /db_xref="GOA:Q4QD88"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="UniProtKB/TrEMBL:Q4QD88"
                     /translation="MADYNAAGADTAVVDDNVPPGITTKQDEIIQYVAKYVVASCDGA
                     RYQDKVRTRTKHNPYFDFLNAKHPYHQYYQYLLESYRHWMRNSEAVGAGTWGGGVDAT
                     QGQGQQQQWNEEDYYQYYGAYAGQASGIEFQGNAAGQLGEGSSYVDASSSAHARNASS
                     GVDPTSYESEAVTATGYGAGYDPSAVDPEPAQVATTAGGGEAQAEEDEDDEYELVMEN
                     GQWVSRKRM"
     gene            <545877..>546710
                     /locus_tag="LMJF_19_1280"
                     /db_xref="GeneID:5651233"
     mRNA            <545877..>546710
                     /locus_tag="LMJF_19_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682659.1"
                     /db_xref="GeneID:5651233"
     CDS             545877..546710
                     /locus_tag="LMJF_19_1280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682711.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651233"
                     /db_xref="GOA:Q4QD87"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="InterPro:IPR001972"
                     /db_xref="InterPro:IPR028512"
                     /db_xref="UniProtKB/TrEMBL:Q4QD87"
                     /translation="MGTCPSISQSEVGIVETCGRFSYTADPGIHCLWCGSVLVRRVTL
                     RLQEYELKVESKTKDNVFVTLSLVIQYQVSPDKLAEVYYACDSSLQCMRDYVLNSIRA
                     KIPLYKLEALYVERGTISQQLKDEVDAIIGTYGIEIVSALISDIDPGAEITKAMNEVQ
                     KFQRLRVASVDAAETEKLKRVRAAEARCEARRLSGEGLAEQRKAIVAGLMHSIEDVQS
                     EVRDLTSNDATNMLLMNQYYDTLQAIAANSSSSVIMLESNGGLEKVAAQLRQGVTHMM
                     R"
     gene            <548689..>549540
                     /locus_tag="LMJF_19_1290"
                     /db_xref="GeneID:5651234"
     mRNA            <548689..>549540
                     /locus_tag="LMJF_19_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682660.1"
                     /db_xref="GeneID:5651234"
     CDS             548689..549540
                     /locus_tag="LMJF_19_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682712.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651234"
                     /db_xref="GOA:Q4QD86"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="InterPro:IPR001972"
                     /db_xref="InterPro:IPR028512"
                     /db_xref="UniProtKB/TrEMBL:Q4QD86"
                     /translation="MTFCGFGCVSTSEVGIIENCGKFDRTADPGCFCIVPCVESVRGV
                     VSLKVAISTVRVETKTRDNAVVNIETRLHYKVIAECAEDAFYRFSNPSEQIASFAASV
                     VRGEVPKYTLDELFLMSDEIKKVVSAELTEKLRGFGFSLESTLLTRIEPSASVKTAIS
                     QTQINAYRRTAAEHESELNKILAVKAAEADYEEKRLSGVGLAQERQAIMKGLKSSIES
                     FVNAVPSMRAKDVMNLLLLNQYFDAMKEVGSGKSNKLILMPNTCGAAPNFMADLVAAQ
                     AGAARMM"
     gene            <551289..>553844
                     /locus_tag="LMJF_19_1300"
                     /db_xref="GeneID:5651235"
     mRNA            <551289..>553844
                     /locus_tag="LMJF_19_1300"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682661.1"
                     /db_xref="GeneID:5651235"
     CDS             551289..553844
                     /locus_tag="LMJF_19_1300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682713.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651235"
                     /db_xref="GOA:Q4QD85"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QD85"
                     /translation="MPFHAHAGQHLLRETAAMGLPELLVPPFEWPLVITALDVLESTN
                     CASVQPPAADVNDVATTFEDIRGDVMEPECVAAPWEAQRHHRGALCCLVQQLAGPQFR
                     VLPWDLDAVQQCVVASTTPSRGPPLSLSALRPRRVFLAESTDFAGRGCVVKLLPAPAP
                     RRSHAHLGAISSATDLPTPGCPALTQRWSPYCPVEEPAVAGEVAALLHLRTAASPRDG
                     RDGVLGRRVLEAHPNVVTLLGVVTAEERVCRCRYAGGIETPIVTAAMMQGAGPVAGGD
                     PAAASLCQVRAVLLENVSGGAWCDFLATYGKFVTPVCVMRWFRDVVTGLAHLHSRSIA
                     HGNLTPANLLVRLTAAGPQGVCGGPGAAAQGYDCVKALLEGLAPSADIVEIAGANGSA
                     VVRSEQMIVSALLERTQLVLSGFRCAARLRNDDGGWAAAETEDDVLWGRSAADKGQRS
                     LRTESRQPRADEVGVCAAAADLWNAAFAFYLLLVGGATAVARGWGALATSDTGVGGAA
                     TPEHLRGFVASRLPRLVRMRFPGALSKGPVQSVDGRSENACEVAPGYAGPEMVARLAS
                     HTDASGATPPLHAAQMGLQLRLLWTALPREFLEILDNILQGDRDAANRQTAAETVRLV
                     DQIMASPPVLQRCIVCVVPPPALLLEQWLDYLRDSWSDSFVCHPMARMPLARALQDAA
                     TRMLCLRVTSGVCNATPRWLQLASWRARLLELEGLLKQPAEVLEEWAAVSNSALLLQS
                     ALRWVSQCRAGTPQLELPRADVTILLGNSVLRALNEVAFAYEEQPDRSRGTSLGFHDA
                     FRCFVARCVAGGQPSPPPLLEELILHVVMAVCSHLPRTFDAREDRLACKYVRG"
     gene            <557293..>560223
                     /locus_tag="LMJF_19_1310"
                     /db_xref="GeneID:5651236"
     mRNA            <557293..>560223
                     /locus_tag="LMJF_19_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682662.1"
                     /db_xref="GeneID:5651236"
     CDS             557293..560223
                     /locus_tag="LMJF_19_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682714.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651236"
                     /db_xref="UniProtKB/TrEMBL:Q4QD84"
                     /translation="MDAVQTGGGHLVSGAASADFTYAEYWRTLMATAEHTGQTLHAEG
                     SHEPVPSLESPTPTPPPPSRRVPPGRWNNAAATVAPRAPPSHLTEAGTYRLNLALTPS
                     PHQAKRLPLPQHQEPLHTTTMSNHVGEGERGEWIARAMRAGKEASAPAEQSIRKPSSA
                     RKSPPPAERARSRVSPPSALDTAAHLSGEDAGAARATDSMREQWARATVIGGTRPVGS
                     TVGDQRDSCAPSGDKDLVDSPRQHSFAAGSTSAQHAFSLTSGAAAVDAVCAYTPDDLV
                     VKAAQCYEQWRRCVMDGSIDTDDGDDSVRECRFSGEDSSMARGGEAADAVHRIIPPDG
                     RAREGAESHGAAAPNYTPSALSRTPTSDRRGALDPDRSKVRLDGKSLLSPACARGKQT
                     PSRAEGTQSRIHSAETTTHGLTSGRRDRDGDTDSTITAAVALASLFTWKDASPAAKSP
                     SPHVALAAPTVFRSISALDEKVAEHLTVEDEVETTVEEQGARSHGALRPSQQERHKHP
                     LIQARHCLHQRVERTPEMATSAARPESAHRTYMSKDVRRVHEASGSLQSSSVAEADVD
                     DAHNAAPLSFVYRRLFADEVEDWGGGVTMWRDVADARHRERGGATNAGGALSLFKPSS
                     GKEGQKRLPAGARDVLAERQSEVTMMVSSDAAHSLATLAEVDHVRETLIELSSSCSSV
                     EDHSDPVGGAELNEDEIASHTEANLHQGASNSSHGAPSLNGNRSNLSLSSASRLSLPS
                     SAWPVDKGKRNGPDQAEMTDSEAQVPPAVAARPLLCRDHPLWCKHHASVSMLYASRLL
                     PSEQANDELQLFLCWAQEKAERQSRWRQHHHNGDTGGSSETVLGTSELGACPHLSCAV
                     AEVYKVAYSVARRGKGAGAPLSRVQRDNASGNSEPDAAVGALPVGFAPAQAASPSRHQ
                     MPPLPHPIVFVAAPLQSSEAASSSTPPEDVDWTVTPSAAPSRFVEWIATEVDPYESLL
                     FSPL"
     gene            <565792..>566160
                     /locus_tag="LMJF_19_1315"
                     /db_xref="GeneID:5651237"
     mRNA            <565792..>566160
                     /locus_tag="LMJF_19_1315"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682663.1"
                     /db_xref="GeneID:5651237"
     CDS             565792..566160
                     /locus_tag="LMJF_19_1315"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682715.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1315"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1315"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651237"
                     /db_xref="UniProtKB/TrEMBL:Q4QD83"
                     /translation="MFGRRVFASAPLPRHMWVKMRIQNAAQAQRMLPSLAPLAAVEGK
                     HSSFCSGLAFNTLCRSSATLGGEEGMVSEDGKLVSAEVAAACAEWCSQALRSAMLPLQ
                     HLAFSSPHSTCLTWQTKMWH"
     gene            <568605..>569741
                     /locus_tag="LMJF_19_1320"
                     /db_xref="GeneID:5651238"
     mRNA            <568605..>569741
                     /locus_tag="LMJF_19_1320"
                     /product="putative glycerol uptake protein"
                     /transcript_id="XM_001682664.1"
                     /db_xref="GeneID:5651238"
     CDS             568605..569741
                     /locus_tag="LMJF_19_1320"
                     /codon_start=1
                     /product="putative glycerol uptake protein"
                     /protein_id="XP_001682716.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651238"
                     /db_xref="GOA:Q4QD82"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:Q4QD82"
                     /translation="MVIMWSTHVTLLYLIEINDGFEQAYWLQYFAPTSKKVAWAVLAE
                     VRIPLWKQRMRWSVAFRMSTLRLIAFNYDLWEATHAAARARDRATAKHDTSCVECAQL
                     REQNAASAAALPAEASRCYKYRTEYARDPADYNFLNYAAYVLFPPLYLAGPMSSFNAF
                     VSYMRVPSTSMPLRKMVRYALSILRIYMTEYTLLHFVHIPCLGSYAFVILRMTLLEQA
                     HFLFYMLAYMWLKFSFIWKSSRLFAMLSGIDVPEDMRRCFGNTLTVRGFWRDWHASFN
                     LWIVRYMYIPMGGRSRVALSVLPIFLFIAVWHDPALHLVKWAVCIAAMFVAEVAVSGR
                     FGWAAAAFRHEMAAAAPHSTRGARMNSQHSCRISIFASKTYFFG"
     gene            <572712..>574787
                     /locus_tag="LMJF_19_1000"
                     /db_xref="GeneID:5651239"
     mRNA            <572712..>574787
                     /locus_tag="LMJF_19_1000"
                     /product="putative glycerol uptake protein"
                     /transcript_id="XM_001682665.1"
                     /db_xref="GeneID:5651239"
     CDS             572712..574787
                     /locus_tag="LMJF_19_1000"
                     /codon_start=1
                     /product="putative glycerol uptake protein"
                     /protein_id="XP_001682717.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651239"
                     /db_xref="GOA:Q4QD81"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:Q4QD81"
                     /translation="MILYGFAAIRDFCDRHAKYYWSKLVYPTPLFLRLGTNGYDNFTD
                     KQWTGFCGQYSKLLAVALLLGAWSALCRHSRASSPLNVSSSPLSSSSSQLSSVTTGKQ
                     RTAIGERRFQGTPLAPAYRFCSEAASTRATRVILYRSSWIPAFYTIVGVVFVIVVHGP
                     HFFLPLLIIIANYVIFSRLQRWCPYWLFMVIMWSTHVTLLYLIEINDGFEQAYWLQYF
                     APTSKKVAWAVLAEVRIPLWKQRMRWSVAFRMSTLRLIAFNYDLWEATHAAARARDRA
                     TAKHDTSCVECAQLREQNAASAAALPAEASRCYKYRTEYARDPADYNFLNYAAYVLFP
                     PLYLAGPMSSFNAFVSYMRVPSTSMPLRKMVRYALSILRIYMTEYVLLHFIHVNAIAT
                     HPFLLLRMTLLEQAHFLVYMLAYMWLKFSFIWKSSRLFAMLSGIDVPEDMRRCFGNTL
                     TVRGFWRDWHASFNLWIVRYMYIPMGGRSRVALSVLPIFLFIAVWHDPALHLVKWAVC
                     IAAMFVAEVAVSGCFGWAAAAFRHEMAAAAPAGEASGAALENGRPAHCAPCRSLLARL
                     ARLSARRLSPRTRAWLHRQIRVVGGMSTVFALIVANLIGFSMQNSSATIAKIGTTLEP
                     TDAEDIIARSFSQWTPWFATGLLVSLYTLSSLAVIDRDMQAHMMSWLRHQYKLNKSAS
                     EATPAEGRT"
     gene            <577319..>579550
                     /locus_tag="LMJF_19_1330"
                     /db_xref="GeneID:5651240"
     mRNA            <577319..>579550
                     /locus_tag="LMJF_19_1330"
                     /product="putative glycerol uptake protein"
                     /transcript_id="XM_001682666.1"
                     /db_xref="GeneID:5651240"
     CDS             577319..579550
                     /locus_tag="LMJF_19_1330"
                     /codon_start=1
                     /product="putative glycerol uptake protein"
                     /protein_id="XP_001682718.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651240"
                     /db_xref="GOA:Q4QD80"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:Q4QD80"
                     /translation="MTRSISPLNMLPTHFSSHCRLHFVSPTTALDIGAADYSTVYPRL
                     CSVEYLVTAATCVGTMLYGFAVLQSFCYKNFFSYQWDTVDPNPFFERMGSEGYDNSID
                     NQWVGFITHYKTFLALALLLAGFSGLYRALLSYSTPSASPVPLDSTACSSLSASSKCS
                     VSLDGHVRVWTPPKWLDKLHSRAHALGSPSAVPRSCTGFLQRPWILPAFYTIVGVVFV
                     IVVHGPHFFLPLLIIIANYVIFSRLQRWCPYWLFMVIMWSTHVTLLYLIEINDGFEQA
                     YWLQYFAPTSKKVAWAVLAEVRIPLWKQRMRWSVAFRMSTLRLIAFNYDLWEATHAAA
                     RARDRATAKHDTSCVECAQLREQNAASAAALPAEASRCYKYRTEYARDPADYNFLNYA
                     AYVLFPPLYLAGPMSSFNAFVSYMRVPSTSMPLRKMVRYALSILRIYMTEYTLLHFVH
                     IPCLGSYAFVILRMTLLEQAHFLFYMLAYMWLKFSFIWKSSRLFAMLSGIDVPEDMRH
                     CFGNTLTVRGFWRDWHASFNLWIVRYMYIPMGGRSRVALSVLPIFLFIAVWHDPALHL
                     VKWAVCIAAMFVAEVAVSECFGWAAAAFRHEMAAAAPAGEASGAALENGRPAHCAPCR
                     SLLARLARLSARRLSPLAQSWVYRQFRVVAGMTTVLGLIIANLVGFSMQNAVATVEKH
                     GLPSSGTDADNVIQKAFRSLTPLFTLGLIAFMYSMSALAAMDRDMARHQTSYLKLYYR
                     LKQ"
     gene            <580595..>582928
                     /locus_tag="LMJF_19_1340"
                     /db_xref="GeneID:5651241"
     mRNA            <580595..>582928
                     /locus_tag="LMJF_19_1340"
                     /product="putative glycerol uptake protein"
                     /transcript_id="XM_001682667.1"
                     /db_xref="GeneID:5651241"
     CDS             580595..582928
                     /locus_tag="LMJF_19_1340"
                     /codon_start=1
                     /product="putative glycerol uptake protein"
                     /protein_id="XP_001682719.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651241"
                     /db_xref="GOA:Q4QD79"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:Q4QD79"
                     /translation="MEPGNAFNEEPEATVQDPSLVSPSSLLQGVALPLLSPSTSVLQP
                     PRTVPSRSCRLHFVSPTTALDIGAADYSTVYPRLCSVEYLVTAATCVGTMLYGFAVLQ
                     SFCYKNFFSYQWDTVDPNPFFERMGSEGYDNSIDNQWVGFITHYKTFLALALLLAGFS
                     GLYRALLSYSTPSASPVPLDSTACSSLSASSKCSVSLDGHVRVWTPPKWLDKLHSRAH
                     ALGSPSAVPRSCTGFLQRPWILPAFYTIVGVVFVIVVHGPHFFLPLLIIIANYVIFSR
                     LQRWCPYWLFMVIMWSTHVTLLYLIEINDGFEQAYWLQYFAPTSKKVAWAVLAEVRIP
                     LWKQRMRWSVAFRMSTLRLIAFNYDLWEATHAAARARDRATAKHDTSCVECAQLREQN
                     AASAAALPAEASRCYKYRTEYARDPADYNFLNYAAYVLFPPLYLAGPMSSFNAFVSYM
                     RVPSTSMPLRKMVRYALSILRIYMTEYTLLHFVHIPCLGSYAFVILRMTLLEQAHFLF
                     YMLAYMWLKFSFIWKSSRLFAMFSGIDVPEDMRRCFGNTLTVRGFWRDWHASFNLWIV
                     RYMYIPMGGRSRVALSVLPIFLFIAVWHDPALHLVKWAVCIAAMFVAEVAVSECFGWA
                     AAAFRHEMAAAAPAGEASGAALENGRPAHCAPCRSLLARLARLSARRLSPLAQSWVYR
                     QFRVVAGMTTVLGLIIANLVGFSMQNAVATVEKHGLPSSGTDADNVIQKAFRSLTPLF
                     TLGLIAFMYSMSALAAMDRDMARHQTSYLKLYYRLKQ"
     gene            <583972..>586305
                     /locus_tag="LMJF_19_1345"
                     /db_xref="GeneID:5651242"
     mRNA            <583972..>586305
                     /locus_tag="LMJF_19_1345"
                     /product="putative glycerol uptake protein"
                     /transcript_id="XM_001682668.1"
                     /db_xref="GeneID:5651242"
     CDS             583972..586305
                     /locus_tag="LMJF_19_1345"
                     /codon_start=1
                     /product="putative glycerol uptake protein"
                     /protein_id="XP_001682720.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1345"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1345"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651242"
                     /db_xref="GOA:Q4QD78"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:Q4QD78"
                     /translation="MEPGNAFNEEPEATVQDPSLVSPSSLLQGVALPLLSPSTSVLQP
                     PRTVPSRSCRLHFVSPTTALDIGAADYSTVYPRLCSVEYLVTAATCVGTMLYGFAVLQ
                     SFCYKNFFSYQWDTVDPNPFFERMGSEGYDNSIDDQWVGFITHYDEFVCLALLLAGFS
                     GLYRALLFYSTPSASPVPPDSTACSSLSASSECSESLDGHVRVWTPPKWLDKLRSRAH
                     ALGSPSAVPRSCTGFLQRPWILPAFYTIVGVVFVIVVHGPHFFLPLLIIIANYVIFSR
                     LQRWCPYWLFMVIMWSTHVTLLYLIEINDGFEQTYWLQYYTSCISSSVQDIQGDAEAP
                     PWEQRMRWSVAFRMSTLRLIAFNYDLWEATHAAARARDRATAKHDTSCVECAQLREQN
                     AASAAALPAEASRCYKYRTEYARDPADYNFLNYAAYVLFPPLYLAGPMSSFNAFVSYM
                     RVPSTSMPLRKMVRYALSILRIYMTEYTLLHFVHIPCLGSYAFVILRMTLLEQAHFLF
                     YMLAYMWLKFSFIWKSSRLFAMFSGIDVPEDMRRCFGNTLTVRGFWRDWHASFNLWIV
                     RYMYIPMGGRSRVALSVLPIFLFIAVWHDPALHLVKWAVCIAAMFVAEVAVSECFGWA
                     AAAFRHEMAAAAPAGEASGAALENGRPAHCAPCRSLLARLARLSARRLSPLAQSWVYR
                     QFRVVAGMTTVLGLIIANLVGFSMQNAVATVEKHGLPSSGTDADNVIQKAFRSLTPLF
                     TLGLIAFMYSMSALAAMDRDMARHQTSYLKLYYRLKQ"
     gene            <589326..>591530
                     /locus_tag="LMJF_19_1347"
                     /db_xref="GeneID:5651243"
     mRNA            <589326..>591530
                     /locus_tag="LMJF_19_1347"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682669.1"
                     /db_xref="GeneID:5651243"
     CDS             589326..591530
                     /locus_tag="LMJF_19_1347"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682721.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1347"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1347"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651243"
                     /db_xref="GOA:Q4QD77"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:Q4QD77"
                     /translation="MAAADTSSFSSLATLRSNSDGVCDRGGGKNGDTDTVLPLNRATT
                     ADAEASANRAYLSRTSLEYIVSVVFVAVVILYSCIYRIACIGREHHEELKENLKPPWA
                     LYRWLGSKGVDITDLQCYYFVVAMPPSIPYLIGFLLLSRRLRRHAASKTATVVNESTT
                     AAAGDGKERSGSMASIHHPEHVIGDSSVGRSSVGPTLLIRKDVSALQFLHIIAGMFIA
                     LCLCGPGFLFGVVIMLLNFYLIAPLYKRVSFRVSMTVMWVMHVLVLFLNYHAGGYRFA
                     WLGLSFLDNLWSPLIQWTTQYSISVLRMISFNSDLWESVSYGEERRQKSLAKHAHTCI
                     DCAQIRDRHRHAVSSLPPEALSCYKCRTECSRHVEEFTLSAYLGYIFYLPLFMAGPVS
                     SFNAYVSYQHYSARSVEGKAIRRYGLRLLSRATLLATMMHYVPIMAILLTPAPSSSGA
                     AEAVSAAGAIAAEGAALARSMGAMAVTTSSFPAGNALRNMVSTTTATTTPTAAAVTLS
                     VMEQMGVTEKASLFLLTLAFLWAKLDVMWRFFRFFALLDGFDPPEDMPHCFANAVSIQ
                     CFWRDWHASFNLWIVRYMYIPMGGSRTKFLSIFPIFFFIAIWHDIELRLIFWAAIICI
                     AFIPEIAVTLFFSSENPVVIRIKRSPLMWRFLRVLGTQLALIELTVANLVGFSVGTTG
                     AVWAAQHMFREMPLTFKIFAPCFYLCSAIIAIQNRDQKTYEQQQLRLKYDLQ"
     gene            <596669..>597871
                     /locus_tag="LMJF_19_1350"
                     /db_xref="GeneID:5651244"
     mRNA            <596669..>597871
                     /locus_tag="LMJF_19_1350"
                     /product="phosphatidic acid phosphatase protein-like
                     protein"
                     /transcript_id="XM_001682670.1"
                     /db_xref="GeneID:5651244"
     CDS             596669..597871
                     /locus_tag="LMJF_19_1350"
                     /codon_start=1
                     /product="phosphatidic acid phosphatase protein-like
                     protein"
                     /protein_id="XP_001682722.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651244"
                     /db_xref="GOA:Q4QD76"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q4QD76"
                     /translation="MVVLSTKEFYYAWNQYHLLDWIVLAILLLISMIVTTSMKPHCRS
                     FSWNDATIGYPSRADTFPDYSLALMVVFSIVFYVIFIWYLVRPLQQFFGEPLDWYCIG
                     GADAVASGEGNAYAEPDTVANTRQPRVRDMQTGRGLVYPWLRAQLWSVGMDSCATAVL
                     KVYAGRLRPDYLSRLKSAGYSSSMSHLPDPQTNPDYYCALMDAHPALKEGRLSFPSGH
                     SSTSFAVCTVVCLFFIAHLRPFARHASFTRLIICLLPISVSLMCAVSRTRDNKHHFSD
                     IIAGSLIGVVSAFLSFYGSFRQVGGAAGIYFSRTAMDIEYEQLRERKLAGGSESSGAA
                     VEIPSAGSSNANYQSTNKREEAARCKSASPISRVNDAVVTFNDSVRRPTWLTERRLNE
                     DPAAVPWI"
     gene            <599404..>599670
                     /locus_tag="LMJF_19_1360"
                     /db_xref="GeneID:5651245"
     mRNA            <599404..>599670
                     /locus_tag="LMJF_19_1360"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682671.1"
                     /db_xref="GeneID:5651245"
     CDS             599404..599670
                     /locus_tag="LMJF_19_1360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682723.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651245"
                     /db_xref="UniProtKB/TrEMBL:Q4QD75"
                     /translation="MTSRVRLLFLACVGIAIVILLVYAQTVVAQGDETNADFAQQEAP
                     ESEKDQHLLRLVVILLPAMFVLWFILCIILAYIYICVCSSYYTK"
     gene            <601413..>601787
                     /locus_tag="LMJF_19_1365"
                     /db_xref="GeneID:5651246"
     mRNA            <601413..>601787
                     /locus_tag="LMJF_19_1365"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682672.1"
                     /db_xref="GeneID:5651246"
     CDS             601413..601787
                     /locus_tag="LMJF_19_1365"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682724.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1365"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1365"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651246"
                     /db_xref="UniProtKB/TrEMBL:Q4QD74"
                     /translation="MFGRRVFASAPLPRHMWAKMHIQNAAQAQRMLPSLAPLVSSVGR
                     STNVLNSQALTQARDGMASDPSPASLEELSVRCFSGSLTTVSSIVFGPVKFTLSVSTP
                     LVSFLELFEQERIKLTHTGLRV"
     STS             601546..603153
                     /standard_name="fb15g12.x1"
                     /db_xref="UniSTS:190176"
     gene            <604070..>606292
                     /locus_tag="LMJF_19_1370"
                     /db_xref="GeneID:5651247"
     mRNA            <604070..>606292
                     /locus_tag="LMJF_19_1370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682673.1"
                     /db_xref="GeneID:5651247"
     CDS             604070..606292
                     /locus_tag="LMJF_19_1370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682725.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651247"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="UniProtKB/TrEMBL:Q4QD73"
                     /translation="MASSTELMPHSERDGFDGSVPYPHHVGETLVSELNTLCRLRDFY
                     EQHTFDTQGPYADLFTLLLTSCKHVIDINVELVHHIKAQQDQQLRQQVACDVLCREAA
                     LQRADIHHLRASLAHLSARGANGEAPMVKCEDDGAGLGSGSAASSHASPKNETATPEC
                     CQHVSQRSPAASLAPQRSTGAAAPSSAAAGLERSSLSTTLASLVGPVSQAHATVTFAP
                     TEAPEQPINSLTRSPPFDHACGGAWAAGMKCRTDAMQGRSATVLVDGQLSSARLDEVQ
                     QKQQQSSTALSAPSDARKHHAEDAVESRLEHLTRHLAVMDQRVHKQRRMWEEEDVGSR
                     SPSASPVAAPGMAGESEFPHPCTTVVGHARSNPQKSIQRQETSVTSPVGTWTPPAVLV
                     RWLDSRLRRWEGEWKRVLEDVQDALLLDATVDAETLRPIAHAAGQQEAHVNLETAQER
                     ASESNEGAEAVMTPSCRGDLVCAIRVLLSCHGTELYKRIVAECNRQVQRTDEELHDLR
                     SRLEALEVYAPHRYAVTARPPLLGVELEDVLEPRIGVRLRTVYHGYLADRAGLNVGDV
                     LVGVGHQSIQTRAQLYVVLGELTRDYSAQCHIQIEAGFMRGFALGDGHCVECNSPHRE
                     ATVDRNGNDYGLDQELQRARSEAAAAAAGGTIPSDAHSPARWLYRHSSLKGRAAMAGS
                     SAAASPFLSTFHSAAQHKEKLAQYLPYFELCLHVVRDGRLRDVTLLIPPWEALRSAAY
                     "
     gene            <609694..>611535
                     /locus_tag="LMJF_19_1380"
                     /db_xref="GeneID:5651248"
     mRNA            <609694..>611535
                     /locus_tag="LMJF_19_1380"
                     /product="putative cation transporter"
                     /transcript_id="XM_001682674.1"
                     /db_xref="GeneID:5651248"
     CDS             609694..611535
                     /locus_tag="LMJF_19_1380"
                     /codon_start=1
                     /product="putative cation transporter"
                     /protein_id="XP_001682726.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651248"
                     /db_xref="GOA:Q4QD72"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:Q4QD72"
                     /translation="MKPSAVAKTTTAGGTAVQLHTHSHRHGGHAHAHTHGSLEKGISG
                     KCLRQCQIATLAGGATNVFFCVTKLWIGSAGGSVALVADGFHSLTDILADIISYVAIS
                     LSRKKLPRCRFPLGIGRLETSGAVIVAAILFFGGVALLVQSLEQCFADVASLLATAAP
                     MGGIAAALAFGARRAMAALRGNSTSAGSPAGHVHAHGSHDHSHEESHGGGDHQGHSHF
                     QVMTYDENTGKQVILWTMVGIATASVVCKELLFRWTRRVGLRAGSRVVVANAYHHRAD
                     AWSGGVALLGVAGQVMGLPGVDGLAGLAVSLSICKIGYGIFKDSVLEFFDYQNAEEVS
                     AIREQLQRFNLRIVRGVDVVPNHKSQNAVKAAASGAEASSTNSPTTASSSDEDDTVHH
                     KRMHFINVFLVRHGHQYAVHVTLLVYESVSAQQIKEAVDLITELARRSLPVQDTFTTL
                     LVCSNYTEPREVSLGGCNDTEGVDEEGAAATSSGATATNYHGHLRAGCSGSFSRAHGS
                     DDSATSTPPIAATGAIINPSLERCIASLQEFHTFTAPIRYSWEERTITAPSSESCECE
                     RDINSVAEMFKCRLISGGFASAKKTAADSAERSGHSCSHGTHADHSD"
     gene            <612673..>613554
                     /locus_tag="LMJF_19_1390"
                     /db_xref="GeneID:5651249"
     mRNA            <612673..>613554
                     /locus_tag="LMJF_19_1390"
                     /product="transcription initiation factor-like protein
                     (TFIID-like protein)"
                     /transcript_id="XM_001682675.1"
                     /db_xref="GeneID:5651249"
     CDS             612673..613554
                     /locus_tag="LMJF_19_1390"
                     /codon_start=1
                     /product="transcription initiation factor-like protein
                     (TFIID-like protein)"
                     /protein_id="XP_001682727.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651249"
                     /db_xref="GOA:Q4QD71"
                     /db_xref="InterPro:IPR000814"
                     /db_xref="InterPro:IPR012295"
                     /db_xref="UniProtKB/TrEMBL:Q4QD71"
                     /translation="MDDDYAFFESDNLVEEELPVIGAFPDPVAEFGGVVGPTGAIGGS
                     ALTADGHLAAAAATLPGGDGAAANLDVDELPPPIKNVQEFLPNVRPDAFPVVVAVQAQ
                     ASIPVGINLAELSCATRNVEYMPNNRIPSATMRLHEPTAVVMMHNSGALSIIGAASVS
                     EARQAAELAARIIRKALNLNFSSLKFRVRSIAARFNVCSPIRLDKLAAYQLDPAMSIG
                     VAKLQVSYEPERFNGCVLRLVGKSSRGDNQWSVSCSVFVTGKVQLMGARSMDELRFAF
                     NAFVPIIAKNLDERKTA"
     gene            <614398..>615084
                     /locus_tag="LMJF_19_1400"
                     /db_xref="GeneID:5651250"
     mRNA            <614398..>615084
                     /locus_tag="LMJF_19_1400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682676.1"
                     /db_xref="GeneID:5651250"
     CDS             614398..615084
                     /locus_tag="LMJF_19_1400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682728.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651250"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QD70"
                     /translation="MSDWETIAKESEKVLVKPDIKGCHEILMKAYEGGNHHPEILWRL
                     GRSYYEMANESTDPAVREPYLKEGMELCKKSVEADPHNFASHKWLGILISDQKVGNKE
                     KIANAYIIRDHFLKAVELNPNDATSLHCMGNWCFKILQIGWLERKAAALILGEPPSST
                     YEECLGYLLRSAEAGNTIHNSTMIGDVYAQQSMHDEARKWYQKAIDMPAYTELQKRNH
                     DAAVAKIKKL"
     gene            <617325..>620126
                     /locus_tag="LMJF_19_1410"
                     /db_xref="GeneID:5651251"
     mRNA            <617325..>620126
                     /locus_tag="LMJF_19_1410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682677.1"
                     /db_xref="GeneID:5651251"
     CDS             617325..620126
                     /locus_tag="LMJF_19_1410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682729.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651251"
                     /db_xref="GOA:Q4QD69"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="UniProtKB/TrEMBL:Q4QD69"
                     /translation="MTEKEANDLIASAFSSEAMAEAVSRVVASGYEKCSLCNNIIEGE
                     AEHVLREHPHVQHIHTMVTKPIPPLPPRGSQDQASMDVGSFAVATSVKADRGEDAFRV
                     VQRARAQLHRLLDGMQGIEGHVYLFGSVVSMGSWDGVGDGDFSFICPKWYTLPAPHGQ
                     AVVREEAVGEDSDDETTAGRKEGKEVEESSSLGEADDFGTVSAPALHHANPGKLVEDA
                     ATEKSQSSVLSLKKEKRIICNIAARLRDAGFRFEELDLVLSTRIPVVRRKRAEQEPPR
                     LHPAPQGSFICARFDTAHAEEQFRNEWLSRVISAYNAEEVPSRGHQRGRSLVLCVPDS
                     IDAIHLMSRWKRKNGVRGEWLGNRRSPEIFSIDFDLSCRCNGIRNSWLLRRYLAQSEV
                     CRVGNVFLKTWSKACGVNNSRVGFLTSYAVSVLWIYFLLRRGEVVFVNPEDIPALPNP
                     EEQMEVPYIPLWPAVADPEADSARTARLGSLLRGFFYFYGEEFDWGTHVATIRQPCDS
                     AADIRTKKDLGWEKSDTLSLVLRDRCYHIFSIEDVYEDDLDLGRHLTPEKAGWIHLQF
                     RLAYRLCCSTRRAGGAAGPSPLWQLFDTPRKRAEDVLHARLYTYLLRNTENAAAPISE
                     ILEQLGVDEESEAVDADAKEDPLYLACAYELGNRLCDLWFDDAQVAQDTAFHKMYNRR
                     SMDYTPPVNPTTCGEWAAVCTDDLQEHHDPTSVHQQRCVRLVPPLRSEAGAPAPHFQA
                     ANAPARERALQLIKSRRQYEECARELGAHAAKKSNQAPAAVVGVPLKRSAAGMLYPHC
                     FYPLQQHRLFKTYEARETFTRCVRDVIGELALLRGADAPAALVERGDVLHDRNKLLRH
                     LEKRLCSSVAVADPTYEAVLQFVCLPTEPYIHAPQLPHGHNERPMFHPTSLFLSLVGG
                     GSSGARVAAKAKVPRARAP"
     gene            <621270..>622334
                     /gene="CPA"
                     /locus_tag="LMJF_19_1420"
                     /db_xref="GeneID:5651252"
     mRNA            <621270..>622334
                     /gene="CPA"
                     /locus_tag="LMJF_19_1420"
                     /product="cysteine peptidase A (CPA)"
                     /transcript_id="XM_001682678.1"
                     /db_xref="GeneID:5651252"
     CDS             621270..622334
                     /gene="CPA"
                     /locus_tag="LMJF_19_1420"
                     /codon_start=1
                     /product="cysteine peptidase A (CPA)"
                     /protein_id="XP_001682730.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651252"
                     /db_xref="GOA:Q4QD68"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013128"
                     /db_xref="InterPro:IPR013201"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="InterPro:IPR025661"
                     /db_xref="UniProtKB/TrEMBL:Q4QD68"
                     /translation="MARRNPFLFAIVVTILFVVCYGSALVAQTPLGVDNFIASAHYGR
                     FKERHGKSFGEDADEGHRFNAFKQNMQTAYFLNTHNPHAHYDVSGKFADLTPQEFAKL
                     YLNPDYYAHRGKDYKEHVHVDDSVLSGAMSVDWREKGAVTPVKNQGMCGSCWAFSAIG
                     NIESQWALKNHSLVSLSEQMLVSCDDIDDGCNGGLMDQAMEWIIQHHNGTVPTEKSYP
                     YASAGGTSPPCHDKGEFGARISGYMSLPHDEKAIAAYVEKKGPVAVAVDATTWQLYFG
                     GVVTLCFGLSLNHGVLVVGFNKRAKPPYWIVKNSWGTSWGEKGYIRLAMGSNQCLLKN
                     YPVTATVDDSNTSHVPTTTA"
     gene            <631606..>632703
                     /locus_tag="LMJF_19_1430"
                     /db_xref="GeneID:5651253"
     mRNA            <631606..>632703
                     /locus_tag="LMJF_19_1430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682679.1"
                     /db_xref="GeneID:5651253"
     CDS             631606..632703
                     /locus_tag="LMJF_19_1430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682731.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651253"
                     /db_xref="InterPro:IPR012981"
                     /db_xref="UniProtKB/TrEMBL:Q4QD67"
                     /translation="MLTVSGLMVGFAFAAKTADESCTYVVNVCGHDSVGPPLARSMNA
                     VDAEYVEHHGVDNLIIPISVSEPKETKRGDYAYCVDVVVHTLLIKKCSRGHRLLEHLT
                     EKLVTLSIEWIRSECGVQLLPRSCRIAGNPLYFDDTVDTPKSIASIIENAAELLQRKS
                     NSSNSRKDEQDTIPDALNLRKAQVPESKQPLIREVISTPAIKKGFLVDGNARLYGPDG
                     SSEGSSKAPDPLAHIPESLRERCRIIDTRNMEGLTASPAKTMKSVDKTANTHTSGTFV
                     APTSEPQGKDEANWARFSIERTGEKVIVRFLAPDSVSSLHDIDLSATKDTLEINGSVT
                     QLPVPIVTDDVRAKFVKATRILVVTCLIDVS"
     gene            <632989..>634080
                     /gene="MPK4"
                     /locus_tag="LMJF_19_1440"
                     /db_xref="GeneID:5651254"
     mRNA            <632989..>634080
                     /gene="MPK4"
                     /locus_tag="LMJF_19_1440"
                     /product="putative mitogen activated protein kinase 4"
                     /transcript_id="XM_001682680.1"
                     /db_xref="GeneID:5651254"
     CDS             632989..634080
                     /gene="MPK4"
                     /locus_tag="LMJF_19_1440"
                     /codon_start=1
                     /product="putative mitogen activated protein kinase 4"
                     /protein_id="XP_001682732.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651254"
                     /db_xref="GOA:Q4QD66"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QD66"
                     /translation="MAQLVPLAELPSGKKIYSVRGQRFEVDREYDLVKVVGFGACGTV
                     CSAVANGSGERVAIKRLSRVFGDLREGKRILREMEIMTSLKHNNLIRLHHFMRPQSKE
                     TFEDIYLVMDLYDTDLNRIIRSRQKLTDEHLQYFMIQAFRGLHYLHSAKVMHRDLKPS
                     NLLVNADCALAICDFGLARDDQVMSSSDLTQYVVTRWYRPPEVLGMGSNQYTSAVDVW
                     SLGLIFAELMVGRALLPGTDYIGQLVMIVNLLGSPSIDDMEFLSSEAKAFILSQPHRP
                     ALSFRDLFSMATEEATDLLSKLLVFHPARRLTAKQVMEHPYFSKYRDAAEEADAPDPF
                     VWNHSHIETKEQLREDLWRVVEAHSQLNE"
     gene            <634460..>636214
                     /locus_tag="LMJF_19_1450"
                     /db_xref="GeneID:5651255"
     mRNA            <634460..>636214
                     /locus_tag="LMJF_19_1450"
                     /product="oxidoreductase-like protein"
                     /transcript_id="XM_001682681.1"
                     /db_xref="GeneID:5651255"
     CDS             634460..636214
                     /locus_tag="LMJF_19_1450"
                     /EC_number="1.14.13.39"
                     /codon_start=1
                     /product="oxidoreductase-like protein"
                     /protein_id="XP_001682733.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651255"
                     /db_xref="GOA:Q4QD65"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR019180"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="UniProtKB/TrEMBL:Q4QD65"
                     /translation="MRRPREPALGECCGSGCTRCVWDIYYDELARFEEFIAGGGIEEE
                     CTQSSEEEEVVDYMGSVVVKYIDPPALPTTGSPGEWERAEMKARGFFPINRIELVSCS
                     TSLFSPTDPGISVVNLFTSAKGRAMLPGDVVEVLVTNSHGTQDADDVERLCKALHLDP
                     CAWCELHRSPFVPEDNFPPWLPLQKPLTLGQLLSAYVDISSSSYLLHQSFFESLFRIY
                     SDSKPSSASSTSTTPSPDPEKVRLLEACASSETGPQLLRLLSKSSTPLCYPSLVDVLE
                     VFSFVNIPLDRLLEVSGPLQTRRYSLANWIPATLPLSPLQLCMREVCARRSANLPAAT
                     PVGADAQRVADMLNRAAQDASRDHGNFFFGHTSHPLCCAARSMTRSAAGAGQRGMYVS
                     FSLFGNSLFARQLQAGCTALCNPAQAKSLCSPLFLIGCGTGIAPLIAAVTQLMLRRAC
                     TAAGSAPFPCWVFYGARTKAELLYDEVLREALRTGAIAKYEYALSREEDNEKQGRYVT
                     DLVKQNRLMVTDSLRNEGQLFVCGPAKALVSVRQLVKCDLLAEPDDDDSVQEQRLLVL
                     EDRGRLNFDIWSTGNIFE"
     gene            <637425..>637775
                     /locus_tag="LMJF_19_1460"
                     /db_xref="GeneID:5651256"
     mRNA            <637425..>637775
                     /locus_tag="LMJF_19_1460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682682.1"
                     /db_xref="GeneID:5651256"
     CDS             637425..637775
                     /locus_tag="LMJF_19_1460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682734.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651256"
                     /db_xref="UniProtKB/TrEMBL:Q4QD64"
                     /translation="MPQDTYFRRAINWMYGDDAYLQNMPTKDLGNKHINELLGRHPYH
                     PYDPDMKADNPCYQFNALFHECMEADHVEGYELYQKHVACYFPYKVDLMKCIAQEKRR
                     HRMEVDVLEKGPKS"
     gene            <638575..>640440
                     /locus_tag="LMJF_19_1470"
                     /db_xref="GeneID:5651257"
     mRNA            <638575..>640440
                     /locus_tag="LMJF_19_1470"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682683.1"
                     /db_xref="GeneID:5651257"
     CDS             638575..640440
                     /locus_tag="LMJF_19_1470"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682735.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651257"
                     /db_xref="GOA:Q4QD63"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QD63"
                     /translation="MGSQSGKASLPTSNQHRAVCDLCGTKVTRKSSLKTGSSLVVKEC
                     SRCHLRCCGECYVWRRYGTSFSTYYDEEHAVAEFVPVCRRCVAEPNLVANAPQYAWNK
                     IFEYCDATAKHHLLQLCHATQMGVVLPYPHARYGWSTFFEGRHFISKGANGEVYHTVV
                     RRDITKELARSLIDALDAKALADLAGRAVAVKAIRKSTVFSLRRWKHIQREVDTLRRC
                     CHRHVVQLHFVAQGPSEVYIVLQYVAGGDLFDWLVRQQIPMEYDVVVIARQLLETLHF
                     MHDVRGVVHRDIKPENILLQPIANPGVQRQGDGSLGADDRCSTEHTNSSDDLYIRLAD
                     FGYAKLLPQNEAGDATLSPGQISRPPLPPVPTDAIGIVGPRADNVQRTEPPAKACKPL
                     LISSTPCGTLGFAAPEILSAYNARKNALERLRSNRQSAEQLGDAAKPRTPVDLVKRMD
                     IFAAGVTICILLTGCEPFPCRSSKEYIEAVHEGLDFSGPQWNYVSQPAKNLLRRMLAP
                     RAADRPSAFECLNSSWMKHQGPYTDATSEAEDDDENARGKGLNRSASVWQLLSTSFRN
                     SVHSLRKNEGWLFVQDAQGLVTTIPRQLVSGREDSESFSEALHSSNGCEQASAVY"
     gene            <642557..>643402
                     /locus_tag="LMJF_19_1480"
                     /db_xref="GeneID:5651258"
     mRNA            <642557..>643402
                     /locus_tag="LMJF_19_1480"
                     /product="eukaryotic translation initiation factor-like
                     protein"
                     /transcript_id="XM_001682684.1"
                     /db_xref="GeneID:5651258"
     CDS             642557..643402
                     /locus_tag="LMJF_19_1480"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor-like
                     protein"
                     /protein_id="XP_001682736.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1480"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651258"
                     /db_xref="GOA:Q4QD60"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:Q4QD60"
                     /translation="MDPNTCAPASAVTDEQPLTLLWGTWEMWCDMPQRQQGQSTENTN
                     WLEQVKSIGLFDSAEGFWGIFNCTILPSQLPPNGSYYLFRKHIAPMWEHEANRRGGKW
                     VIPFTGKASRSEGDLQPVDEAWQTLCLSAIGELFPGDEEEICGVTVSRGRQRTLPSGH
                     ATSALSEWKLCLWTRSADNRGSQIRIAEYIRKQLHLQPPSKEASRDGKSGEQDTLMEM
                     PRSPDRSPVAKMREASGIPSAMTYVAHRDLMEAKQEFVKGGSSVAQAFRPKYTLAIDV
                     RNEGV"
     gene            <645899..>646864
                     /locus_tag="LMJF_19_1490"
                     /db_xref="GeneID:5651259"
     mRNA            <645899..>646864
                     /locus_tag="LMJF_19_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682685.1"
                     /db_xref="GeneID:5651259"
     CDS             645899..646864
                     /locus_tag="LMJF_19_1490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682737.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1490"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651259"
                     /db_xref="GOA:Q4QD58"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:Q4QD58"
                     /translation="MSTEHARNLLYLALNAFSSIGIVYTNKVIFTRHGFSYGTLLTVI
                     HFFITTLGLFICRMMGVFEPKRIPVLKILPLCVGFCGFVALNNVSLVYNSIGFYQLMK
                     VLTTPMLVVIQTLFYQKTFSAKVKLSLTVTCIGVGLSTVSDTSANLAGTVVALSTLLI
                     TCMYQIWVGTKQSEFQCDGFQLLYNQAPISCAMLMPMAYFADDLANKYYTPCWPTIIV
                     IIFSGLLAFFVNISIFLVIGKTSPVTYNVLGHFKLCVILFLGFLWFGDQMNARIFLGI
                     VITLFGVFWYTHLKMQEEKKEERAQILAKHAEEHVNVGEGDEKYV"
     gene            <648165..>649010
                     /locus_tag="LMJF_19_1500"
                     /db_xref="GeneID:5651260"
     mRNA            <648165..>649010
                     /locus_tag="LMJF_19_1500"
                     /product="eukaryotic translation initiation factor-like"
                     /transcript_id="XM_001682686.1"
                     /db_xref="GeneID:5651260"
     CDS             648165..649010
                     /locus_tag="LMJF_19_1500"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor-like"
                     /protein_id="XP_001682738.1"
                     /db_xref="GeneID:5651260"
                     /db_xref="GOA:Q4QD60"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:Q4QD60"
                     /translation="MDPNTCAPASAVTDEQPLTLLWGTWEMWCDMPQRQQGQSTENTN
                     WLEQVKSIGLFDSAEGFWGIFNCTILPSQLPPNGSYYLFRKHIAPMWEHEANRRGGKW
                     VIPFTGKASRSEGDLQPVDEAWQTLCLSAIGELFPGDEEEICGVTVSRGRQRTLPSGH
                     ATSALSEWKLCLWTRSADNRGSQIRIAEYIRKQLHLQPPSKEASRDGKSGEQDTLMEM
                     PRSPDRSPVAKMREASGIPSAMTYVAHRDLMEAKQEFVKGGSSVAQAFRPKYTLAIDV
                     RNEGV"
     gene            <649793..>650137
                     /locus_tag="LMJF_19_1505"
                     /db_xref="GeneID:5651261"
     mRNA            <649793..>650137
                     /locus_tag="LMJF_19_1505"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682687.1"
                     /db_xref="GeneID:5651261"
     CDS             649793..650137
                     /locus_tag="LMJF_19_1505"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682739.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1505"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1505"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651261"
                     /db_xref="UniProtKB/TrEMBL:Q4QD59"
                     /translation="MFGRRVASCCCIPANMYARLHISSPQQANRMLPPLVPITTSICR
                     SVSGGTGAFASLVAGSEAVPADLTSPGNLLSLLGVTPQVLLGAINANTLLLRIISDTM
                     CTYSVILLHAIG"
     gene            <651506..>652471
                     /locus_tag="LMJF_19_1510"
                     /db_xref="GeneID:5651262"
     mRNA            <651506..>652471
                     /locus_tag="LMJF_19_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682688.1"
                     /db_xref="GeneID:5651262"
     CDS             651506..652471
                     /locus_tag="LMJF_19_1510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682740.1"
                     /db_xref="GeneID:5651262"
                     /db_xref="GOA:Q4QD58"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:Q4QD58"
                     /translation="MSTEHARNLLYLALNAFSSIGIVYTNKVIFTRHGFSYGTLLTVI
                     HFFITTLGLFICRMMGVFEPKRIPVLKILPLCVGFCGFVALNNVSLVYNSIGFYQLMK
                     VLTTPMLVVIQTLFYQKTFSAKVKLSLTVTCIGVGLSTVSDTSANLAGTVVALSTLLI
                     TCMYQIWVGTKQSEFQCDGFQLLYNQAPISCAMLMPMAYFADDLANKYYTPCWPTIIV
                     IIFSGLLAFFVNISIFLVIGKTSPVTYNVLGHFKLCVILFLGFLWFGDQMNARIFLGI
                     VITLFGVFWYTHLKMQEEKKEERAQILAKHAEEHVNVGEGDEKYV"
     gene            <657485..>659842
                     /locus_tag="LMJF_19_1520"
                     /db_xref="GeneID:5651263"
     mRNA            <657485..>659842
                     /locus_tag="LMJF_19_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682689.1"
                     /db_xref="GeneID:5651263"
     CDS             657485..659842
                     /locus_tag="LMJF_19_1520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682741.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651263"
                     /db_xref="UniProtKB/TrEMBL:Q4QD57"
                     /translation="MSAAESFASPSASRILPADVADSICQDEEREGRSTYCSSHITRL
                     VYETSCTVPAMNAASSSSPASSLTVKSPPEEAWTSDEDAMERLYAVKPTSTIFGSDLD
                     RLERDMMRDYHQRGARLPPRDRVYAEFGGSQRGRRMQWEPSSSFDRLAASDFRFHARS
                     ETVVGDDTNRNLAAYHLYAEAYQTQQEESRRSQRGRATKSKGVSLCRIDQGASVGAET
                     DLPASENPHFPTGGPSDANHSRASSSEHVGESDEVLLSGVRSAPKEVVVNARTDYKAR
                     LSIVSSPPCEGEDANRIVYDAYNQRPTDNALLEVRGADYWGHYENRRRVEERSAYRQE
                     AIKREVLQEGAVDTSEVEYSTNKVRKETLLYFQAHPINEMIQEPFVRIRQFVPPGGGP
                     SVSLDPNEPLPTPAESENGSQRVIESVNMDADIPVQEARQMAQELGLDLIRIGAIYSQ
                     KTDRRIIALCMIGDHREHMREMIKFKIQKLGVQPPPTKECIEVPFKGGTHPHAIRFKC
                     VGVAKHLLHRHAIRINLTKFGTPREGFPVFQSILDELKRQCMRLKAYHTAGQIQSNYD
                     EIFCYLYPSTGRSPKTTVTHPTPQQVLEARDERVLENEKEIYFDDLQDKATRKQRLQY
                     MLKLENGTAWAEKDEGMSLQRQRAIKVMLGYLPKGNRELYAARGDVNIPAPFRASHPT
                     SVHKWSYPSESNLEQASRGAAALGKRAAMPISEMHDAGETPESPTQLDRFYYTAQGPA
                     LEMGEFKEALGLKDNRARRPPMGAGFSTLGVGSVDETVQNGFATK"
     gene            <660939..>662237
                     /locus_tag="LMJF_19_1530"
                     /db_xref="GeneID:5651264"
     mRNA            <660939..>662237
                     /locus_tag="LMJF_19_1530"
                     /product="peptidylprolyl isomerase-like protein"
                     /transcript_id="XM_001682690.1"
                     /db_xref="GeneID:5651264"
     CDS             660939..662237
                     /locus_tag="LMJF_19_1530"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="peptidylprolyl isomerase-like protein"
                     /protein_id="XP_001682742.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651264"
                     /db_xref="GOA:Q4QD56"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:Q4QD56"
                     /translation="MSDQPISSSASAVSEASQPPMEVAYPLNEEVEVPGTDGGLYKTV
                     LVEGAGSQPVKGAKVTVHYVGTLLDGTTFDSSRDRGDCFEFTLGRGQVIKGWDKGVST
                     MRTGEKALLKCSPEYAYGAAGSPPTIPANATLLFEVELFHWTREVDISAAKDKSLMMS
                     VLKDGVDYENPDFESSVTMDLLIYVGEFDPENKDKYTPVKTMSDWKAVVGVTSLPPHL
                     EAFLYKMRKRESAACRVRSDLICDAVPEFAIPSSAERGHCDVTYVVEISELSHVKTYD
                     FTGAAKVAEGEKRKNSGNDAFKAGKLDLAERFYRRAMEFIGQDYGFDDTVKPECHRVR
                     IGVMGNLAQVLLMRNKYTESADFSRKVLSLDSNNTKALFRLAKALDGLQDWDEASKCV
                     AHILAIDPGNADAANLKVRLMQEQRTFDQKQKSMFKKMFA"
     gene            <666735..>669332
                     /locus_tag="LMJF_19_1540"
                     /db_xref="GeneID:5651265"
     mRNA            <666735..>669332
                     /locus_tag="LMJF_19_1540"
                     /product="choline/Carnitine o-acyltransferase-like
                     protein"
                     /transcript_id="XM_001682691.1"
                     /db_xref="GeneID:5651265"
     CDS             666735..669332
                     /locus_tag="LMJF_19_1540"
                     /codon_start=1
                     /product="choline/Carnitine o-acyltransferase-like
                     protein"
                     /protein_id="XP_001682743.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651265"
                     /db_xref="GOA:Q4QD55"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:Q4QD55"
                     /translation="MSEAFLSQRPHPANQTRDAGSSVMQMRVSWTCNGLDIHVPPVRY
                     IWRGVHRSIVDNIDKVSAMVYPIPFSCVVACAAGSCVCVWYVPQTSWVHTNPASTWLR
                     YFDSIVTPLSRYLPPSFQAPVLCAKAWAVTLAAATVLHRFALRRLLQYKGWMLERNPQ
                     QPSWRTRVWSLVMRAFFTRPSIPKTRVYGSCLPSVPLPSLQQTVSSYLSSMRSLYHQK
                     DSDVNEWLELRRSAESFLLNEGPSLQMHLRLQNVMGHSYVPELWTRNVFLAARDSLCL
                     HSNFYTVPFATHLPTTLPEARAAVLIYLLTQLKGHIERRTLCPNFIGPRNCVPLSMDQ
                     YSMAFNTTRIPGREIDVLEHRGERENSYLVILHRGRVYQMSVIDPQTGRQLTPHQLEV
                     VLHQLLLEVEEEVSTGRDESEEDDAEDTLETLGKKRSYRVVEALLPVLTTASRAQWAD
                     VRTSYLLHDSNNSGPLRIIEKALFVVSFDERCGTAAPSKASSTVDEVKRLSMDCAHYL
                     CGNGSNLWCDKSFNLVVRSDGHAGLHVEHSWSDMSTFLGFFEHVSAQEESADLWYDTE
                     SGHAKKLPEDKRRAKPFRAPNIDNQLCPKRLRFTIHKKLAAAIRRVHTEFLLNTSSQV
                     DLHVVRYSGYGCEVPKSMGCSPDAWVQMAIQLAHYIDQGGHFRLVYESVPQRMFAKGR
                     TEAVRSVTDVSSAFVKAMASTGGEDDAMAAEEKRALLIDACANHQRAVQEAVAGGGVD
                     RHLFALFMASTSQETPSDFLTAALRKTKWKVSSAQAHQRNLLDRLHPAGGGSCYHETP
                     GFGFGPVSPDGYGISYCFCANEVLYVTITSYKNCDATSSRTLGNHMTRALDMLGALSA
                     SGRDDSAPR"
     gene            <670369..>671574
                     /locus_tag="LMJF_19_1550"
                     /db_xref="GeneID:5651266"
     mRNA            <670369..>671574
                     /locus_tag="LMJF_19_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682692.1"
                     /db_xref="GeneID:5651266"
     CDS             670369..671574
                     /locus_tag="LMJF_19_1550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682744.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651266"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QD54"
                     /translation="MLASGSSSAEGGAKRFSRQQIIQHVKKSLLYTAFDVRWVPQTAS
                     FAVVGQYPNNHGALSVYQLHHGDVQPTVEVRLPHPLKCCTFGHNISFSSSGSGSGGNS
                     SSITAANATMNQIATGDFAGSLQIFDLSRLGSTPPSAPNALSDVTAASVLHIPHAHES
                     IINAIDGARYSGPPEVATGSRDGSVKVWDTRQSNKPVVSLNPADPARARDCWTVRLGN
                     SFDPDERVVAAGYDNGDVKIFDLRTQKMLHEMHVNNGVCDLEFDRPDIPMNKLLVSSL
                     EGRVRCYDMRTLHPKLGYAYVEERVSEGTVWCSRALPQNREIFLSGGGGELTLCLYKY
                     PPERTLKDGDGLQRGVAGAVEELNKAKIGDQPINAMDWNRSKEGLAVCASFDQSIRVM
                     LVTKLGLLS"
     gene            <673010..>674554
                     /locus_tag="LMJF_19_1560"
                     /db_xref="GeneID:5651267"
     mRNA            <673010..>674554
                     /locus_tag="LMJF_19_1560"
                     /product="inosine-5'-monophosphate dehydrogenase"
                     /transcript_id="XM_001682693.1"
                     /db_xref="GeneID:5651267"
     CDS             673010..674554
                     /locus_tag="LMJF_19_1560"
                     /EC_number="1.1.1.205"
                     /codon_start=1
                     /product="inosine-5'-monophosphate dehydrogenase"
                     /protein_id="XP_001682745.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651267"
                     /db_xref="GOA:Q4QD53"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001093"
                     /db_xref="InterPro:IPR005990"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR015875"
                     /db_xref="UniProtKB/TrEMBL:Q4QD53"
                     /translation="MATNNANYRIKTIKDGCTAEELFRGDGLTYNDFIILPGFIDFGA
                     ADVNISGQFTKRIRLHIPIVSSPMDTITENEMAKTMALMGGVGVLHNNCTVERQVEMV
                     KSVKAYRNGFISKPKSVPPNTPISNIIRIKEEKGISGILVTENGDPHGKLLGIVCTKD
                     IDYVKNKDTPVSAVMTRREKMTVERAPIQLEEAMDVLNRSRYGYLPIVNENGEVVNLC
                     SRRDAVRARDYPHSTLDKSGRLICAAATSTRPEDKRRVAALADVGVDVLVLDSSQGNT
                     IYQIAFIKWVKSTYPHLEVVAGNVVTQDQAKNLIDAGADGIRIGMGSGSICITQEVLA
                     CGRPQGTAVYKVAQYCASRGVPCTADGGLRQVGDICKALAIGANCAMLGGMLSGTTET
                     PGEYFFKGGVRLKVYRGMGSLEAMSQGKESGKRYLSENEVIQVAQGVSGNVVDKGSAA
                     KLIAYVSKGLQQAAQDIGEISFDAIREKMYAGQVLFNRRSPTAQGEGGVHSLHSYEKK
                     LFAAKM"
     gene            <676609..>677355
                     /locus_tag="LMJF_19_1570"
                     /db_xref="GeneID:5651268"
     mRNA            <676609..>677355
                     /locus_tag="LMJF_19_1570"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682694.1"
                     /db_xref="GeneID:5651268"
     CDS             676609..677355
                     /locus_tag="LMJF_19_1570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682746.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651268"
                     /db_xref="GOA:Q4QD52"
                     /db_xref="InterPro:IPR006816"
                     /db_xref="UniProtKB/TrEMBL:Q4QD52"
                     /translation="MERSLYYTPQLLWLQVMDRMPYEFTHYFVSSPPPHHEAMLSGIR
                     EQYGRPYSAAKPFDVELLGRLWNGHSRVMFATDNLVFSAVDHSVSDRWKEMGFQGTDP
                     STDFRGAGIFGLAQLVYLVEHHPEEWSAILTPDFMAAAAGLNVTMRLATMLGINSSLN
                     QLSSSVLSKYSAREARLQLCRFIFDPSVDVATQRLSEVYCFAMRLLHYRWMRSTRNIM
                     EFNQQLSSMYTELDRLLFLCNTLEELCSLL"
     gene            <678253..>679437
                     /locus_tag="LMJF_19_1580"
                     /db_xref="GeneID:5651269"
     mRNA            <678253..>679437
                     /locus_tag="LMJF_19_1580"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682695.1"
                     /db_xref="GeneID:5651269"
     CDS             678253..679437
                     /locus_tag="LMJF_19_1580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682747.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651269"
                     /db_xref="UniProtKB/TrEMBL:Q4QD51"
                     /translation="MKRTHNIDAQICQRKRLRTCSVPLIGDCMRQLAEQLRGWDGVVA
                     VDPLACASFHEEAVARIALEALSLLLLDKVSERRTDGMCAHRRTWYGIGVLRGRESDV
                     AYNCGEGASVLWNVVPLALTVVPWQVSLPLRLQDLVLCQGHFASIDQLDYGSSDVGPV
                     PDSFLMREAVALLCGLPRCRVQAVSGRFPLFGRVAPPSFLAAPRGVAATGATWSLVPS
                     REVSPARCAAAAQRHARRLMPFLVSGLSSLMEPFSPRSDRSVPECWAVVSYPDGLPRA
                     EAAREEVDGVSRDNSDTAGAASARETNVRESDGSCEAAPFFILPSHLLCRSLRVAVGW
                     QKISPSSRPLASEVLQRLCCLVDRVALRTDRGVTLTSRTACSTGQETLSATTTIQKAS
                     SM"
     gene            <680419..>682215
                     /locus_tag="LMJF_19_1590"
                     /db_xref="GeneID:5651270"
     mRNA            <680419..>682215
                     /locus_tag="LMJF_19_1590"
                     /product="putative ATP-dependent zinc metallopeptidase"
                     /transcript_id="XM_001682696.1"
                     /db_xref="GeneID:5651270"
     CDS             680419..682215
                     /locus_tag="LMJF_19_1590"
                     /codon_start=1
                     /product="putative ATP-dependent zinc metallopeptidase"
                     /protein_id="XP_001682748.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651270"
                     /db_xref="GOA:Q4QD50"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QD50"
                     /translation="MDPLQREASKNGEEGAAGAKSPSYFRGFFDAEKRRKVVNHDPTV
                     GQAIGGAVVMALPVALIIALVMRRRARLTTQAPSGAAPKEGGFFSEMQKMMRQTMNPM
                     GEKDFKVSVKDTKFSDVIGVPEALAEVQQYVNFLKTPQVFTRLGGRLPKGCILTGEPG
                     TGKTLLAKAVAGEASVPFYSCSGADFIEVYAGSGPKRVRELFAAAKKDAPSVIFIDEI
                     DAVGSRSSGNGAMGLSSEENRTINQLLAELDGLQSNEAVVVFAATNFVDSLDKALLRE
                     GRFDRKVEIPMPDRQARQDLFHHYLTRVACEDAVSLSKKLAELTPGVSPATIAAIVNE
                     GALSAAIKDNAVVTAVDLLPAIDDVLVGKKHRSRMSDDAARRVALHESGHALVAWLLP
                     EQTDVVKISITPRGPAGGFTQQVGREVLDMATEFSLFTDVCVMLGGRLAEMTQHESLT
                     TGAQDDYQRATQTAIREFLAFGMSRQVGLLSYEPQRLSEGRMHQKHSEAAHKMAEEEA
                     ARLVAAASDHVKMLLRSHDAVLQKLAASLFERKELLREDIEAIVGPRPGTSSAVSEQT
                     RAALRRFVDASEAAALQRQTAREAICATLSTA"
     gene            <683048..>683548
                     /locus_tag="LMJF_19_1600"
                     /db_xref="GeneID:5651271"
     mRNA            <683048..>683548
                     /locus_tag="LMJF_19_1600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682697.1"
                     /db_xref="GeneID:5651271"
     CDS             683048..683548
                     /locus_tag="LMJF_19_1600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682749.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651271"
                     /db_xref="GOA:Q4QD49"
                     /db_xref="InterPro:IPR002778"
                     /db_xref="UniProtKB/TrEMBL:Q4QD49"
                     /translation="MQQPRPGPAQAAPRSYDKKAYQTIYPQYLDSYLTPSEGRRLTKS
                     QGVEHPTMEEILQALRVLGYKDVIVDPARSYPRSQSTTKFPMVPRGCIKVAIKTPVDE
                     HYIKKSDFDTQTRSAVVNNIDTKQELLRRVAALIKEKMPNRPQLATVEGIITAYNPTP
                     QPKSKK"
     gene            <684470..>685306
                     /locus_tag="LMJF_19_1610"
                     /db_xref="GeneID:5651272"
     mRNA            <684470..>685306
                     /locus_tag="LMJF_19_1610"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682698.1"
                     /db_xref="GeneID:5651272"
     CDS             684470..685306
                     /locus_tag="LMJF_19_1610"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682750.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651272"
                     /db_xref="GOA:Q4QD48"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QD48"
                     /translation="MSARRSRLRRVWWLPHQRIVVLKDVDLWAEDCVTEGVDVVAERL
                     WRMRVDASRSGRAQYLAEYLALHVDSSRHHQWLLSSYGPSLRDVLLTPSLIPFTEKRC
                     KGVLRRVLLALDQLHRVSMYVHADVSLGNVLTSPSSCDDVVLGDLESVSPIGEVPSGC
                     LGSYFFMAPERLVDGALPLAPHDDVWAFGVVCYNLLTWDVTHPWCALGSESDHSENYW
                     AFLDLMSKAKDVPPYQLLLQSPLSRCSKEALAFVAVCLSWDPACRPSAAELLQHSWML
                     CP"
     gene            <685775..>686701
                     /locus_tag="LMJF_19_1620"
                     /db_xref="GeneID:5651273"
     mRNA            <685775..>686701
                     /locus_tag="LMJF_19_1620"
                     /product="putative potassium voltage-gated channel"
                     /transcript_id="XM_001682699.1"
                     /db_xref="GeneID:5651273"
     CDS             685775..686701
                     /locus_tag="LMJF_19_1620"
                     /codon_start=1
                     /product="putative potassium voltage-gated channel"
                     /protein_id="XP_001682751.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651273"
                     /db_xref="GOA:Q4QD47"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR003131"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:Q4QD47"
                     /translation="MHRIVKVNVGGRYFQTRLSTLLRFPDTSFARMFEGLASTSALPP
                     TLSPPPQPTESEDVFVDANPDVFEKVLGFLRTNRIQLPLNDECLRAELVHHLNSWDLM
                     PHAFPASAADGAVEGEEAHRIELPDVCVVQLCDHMQHDQGVKRHAMTITYGADGFQLR
                     KLTQMIRRDLNQQLSSTYWQCYQTNERAAFFATTKVANGAADILTTSITQQVVQHTER
                     LGYHLATSYVTLSPDVVHTSVRMLIHNFIFRRVRLPALEAADEASLLGDEGDEVETYQ
                     NFEPRPVGPQKVQWADSPSRPPAQDVSTDLWK"
     gene            <687260..>687637
                     /gene="ATG8"
                     /locus_tag="LMJF_19_1630"
                     /db_xref="GeneID:5651274"
     mRNA            <687260..>687637
                     /gene="ATG8"
                     /locus_tag="LMJF_19_1630"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001682700.1"
                     /db_xref="GeneID:5651274"
     CDS             687260..687637
                     /gene="ATG8"
                     /locus_tag="LMJF_19_1630"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001682752.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651274"
                     /db_xref="GOA:Q4QD46"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QD46"
                     /translation="MSSRVAGSYKKAHTLEARLRDAEKVRERAPDRILVICEKAENSP
                     VPDLDKSKFLVPPDATVGGFLVSIRRRITMEAEKALFLFVGDSVPANSTLMSDLFNRY
                     KDEDGFLYVTYSGENTYGGQGLH"
     gene            690826..690899
                     /gene="LM5Cs1C2.6"
                     /locus_tag="LMJF_19_snoRNA0004"
                     /db_xref="GeneID:12982181"
     ncRNA           690826..690899
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C2.6"
                     /locus_tag="LMJF_19_snoRNA0004"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460231.1"
                     /db_xref="GeneID:12982181"
     gene            690992..691087
                     /gene="LM5Cs1C3.6"
                     /locus_tag="LMJF_19_snoRNA0003"
                     /db_xref="GeneID:12982182"
     ncRNA           690992..691087
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C3.6"
                     /locus_tag="LMJF_19_snoRNA0003"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460230.1"
                     /db_xref="GeneID:12982182"
     gene            <691861..>693882
                     /locus_tag="LMJF_19_1640"
                     /db_xref="GeneID:5651275"
     mRNA            <691861..>693882
                     /locus_tag="LMJF_19_1640"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682701.1"
                     /db_xref="GeneID:5651275"
     CDS             691861..693882
                     /locus_tag="LMJF_19_1640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682753.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.19.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.19.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651275"
                     /db_xref="GOA:Q4QD45"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q4QD45"
                     /translation="MLHHRHTLPESLFHVSYEPSTSSSTFVTEAPTPIDDVVAVTSQR
                     GDSPLSSCDSRDAPRSLVPGDLSMHRSFLCYVCCEPLFRAMSDGVCGHHVCEACCLKM
                     SVSGTATCPLCGWNGSWSTDAAYSECVRDAVEARLKESAVVLLRDAYPALSSGCVGDV
                     VDSCFDRSCLTVDLHQAQQYLAAVPPDGVGAVCTSLAAPDKIPNKAAVFSLRVEGPWL
                     TSCDLVRRFLQLQVLVLCDCADLVSLRGVECAPLLERLTAERCGLVDTLGIDACPCLK
                     SLQLRECPRLSHLGWNQILNSQSSLQESSGQDGGCAALLSVSVFRCPAFQGIGLLSAA
                     PHLREFRAQRVRISSLDALRECRHLELLDVGGCQQVCCIEALRGAKALRYLDLSNTAV
                     SDIGALSQCTALERVNLSGCLRLRSLDSLECCTELRELQASRTNIETLIGLRLCRALK
                     KVDVSGCAALRDAAALTHLSQLTHVDLSFTAVDDVSSLAYYSGLESVRLRGCRYLRDY
                     SPPHNLEDAPPLRSLDLSNTSVCSISEWGRCPPRLEKLRMNGCTRLSDISVLQSSTGL
                     RIVDLGNTSVHSISPLISCAPALEELRMHGCTELSDISVLQSASRLRVVDLDNTSVRS
                     VSPLRLAASELEELRINDVTYQGEVPIFQSTGVQRRCNMINTGASSRSL"
     gene            <698855..>700654
                     /gene="LPG1G2"
                     /locus_tag="LMJF_19_1650"
                     /db_xref="GeneID:5651276"
     mRNA            <698855..>700654
                     /gene="LPG1G2"
                     /locus_tag="LMJF_19_1650"
                     /product="putative GIPL galf transferase"
                     /transcript_id="XM_001682702.1"
                     /db_xref="GeneID:5651276"
     CDS             698855..700654
                     /gene="LPG1G2"
                     /locus_tag="LMJF_19_1650"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /product="putative GIPL galf transferase"
                     /protein_id="XP_001682754.1"
                     /db_xref="GeneID:5651276"
                     /db_xref="GOA:Q4QD44"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q4QD44"
                     /translation="MRKSTSVYTLRSHRCFITLRAVIPILIFICLCGAVGTIFLTSSH
                     QSALGWTREPTTSAPSGELTTTEPGEPRRSMTPTSAITTSAPATATTAEQTPLPPEQT
                     SMFDAPGTPTPAVSAASARATGAQDSSTLMEGAKTETTKQNLAMKGLDRWMKMQLPAD
                     WMECIRQNLQLDKHGQPMHAVTEMKDAIPLLITPLTGDVKFFPYFVCSMDVAVRYHYV
                     IQNERDPDTTAVIDDLQRRFGNSGRLLVVRNRYNRGYSGSMNQAFEWALKERTAEEVP
                     WVFACGVDAIFEPGLLAKMIEVVQQNTRGDAAMLAALRAEVELEERLVREGNYSYYER
                     WAPRGRPLKVLRSGYPGVPLNVRTAPLLPDRIRYTVADENRESGIVRPAELRTRFFGN
                     YVATVTPVPDALGTIAVTRLALSAVGYFDENYFPAYMDDIDLRWRHFAYGFGALHGER
                     NGPVTRWHHYNAANLRGSPFVDPDLEKYGTEDNYSRRAFLSYIRRSKGIYDKLKYGPR
                     DMDGVWRQAAQKAEFKYSSFNVSHYPADTWVLDEDARGCMFHHTYNYKTQNWSRPSDC
                     SYNPRTLEESGILGVDQLASYRSMLAEKAFAYQ"
CONTIG      join(FR796415.1:1..702208)
//
DBGET integrated database retrieval system