GenomeNet

Database: RefSeq
Entry: NC_007607
LinkDB: NC_007607
Original site: NC_007607 
LOCUS       NC_007607             182726 bp    DNA     circular CON 24-MAY-2020
DEFINITION  Shigella dysenteriae Sd197 plasmid pSD1_197, complete sequence.
ACCESSION   NC_007607
VERSION     NC_007607.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603600
            Assembly: GCF_000012005.1
KEYWORDS    RefSeq.
SOURCE      Shigella dysenteriae Sd197
  ORGANISM  Shigella dysenteriae Sd197
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Shigella.
REFERENCE   1  (bases 1 to 182726)
  AUTHORS   Yang,F., Yang,J., Zhang,X., Chen,L., Jiang,Y., Yan,Y., Tang,X.,
            Wang,J., Xiong,Z., Dong,J., Xue,Y., Zhu,Y., Xu,X., Sun,L., Chen,S.,
            Nie,H., Peng,J., Xu,J., Wang,Y., Yuan,Z., Wen,Y., Yao,Z., Shen,Y.,
            Qiang,B., Hou,Y., Yu,J. and Jin,Q.
  TITLE     Genome dynamics and diversity of Shigella species, the etiologic
            agents of bacillary dysentery
  JOURNAL   Nucleic Acids Res. 33 (19), 6445-6458 (2005)
   PUBMED   16275786
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 182726)
  AUTHORS   Yang,J., Chen,L. and Jin,Q.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2007) State Key Laboratory for Moleclular
            Virology and Genetic Engineering, Microbial Genome Center of
            Chinese Ministry of Public Health, 6 Rongjing Eastern Street, BDA,
            Beijing 100176, P.R.China
  REMARK    Protein update by submitter
REFERENCE   3  (bases 1 to 182726)
  AUTHORS   Yang,J., Chen,L. and Jin,Q.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUL-2007) State Key Laboratory for Moleclular
            Virology and Genetic Engineering, Microbial Genome Center of
            Chinese Ministry of Public Health, 6 Rongjing Eastern Street, BDA,
            Beijing 100176, P.R.China
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 182726)
  AUTHORS   Jin,Q., Yang,F., Yang,J., Jiang,Y., Yan,Y., Chen,L., Zhang,X.,
            Peng,J., Tang,X., Xiong,Z., Nie,H., Dong,J., Xue,Y., Xu,X., Zhu,Y.,
            Shen,Y., Qiang,B. and Hou,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-2004) State Key Laboratory for Moleclular
            Virology and Genetic Engineering, Microbial Genome Center of
            Chinese Ministry of Public Health, 6 Rongjing Eastern Street, BDA,
            Beijing 100176, P. R. China
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            CP000035.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 05/23/2020 21:43:54
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 4,794
            CDSs (total)                      :: 4,681
            Genes (coding)                    :: 3,540
            CDSs (with protein)               :: 3,540
            Genes (RNA)                       :: 113
            rRNAs                             :: 8, 7, 7 (5S, 16S, 23S)
            complete rRNAs                    :: 8, 7, 7 (5S, 16S, 23S)
            tRNAs                             :: 84
            ncRNAs                            :: 7
            Pseudo Genes (total)              :: 1,141
            CDSs (without protein)            :: 1,141
            Pseudo Genes (ambiguous residues) :: 0 of 1,141
            Pseudo Genes (frameshifted)       :: 511 of 1,141
            Pseudo Genes (incomplete)         :: 567 of 1,141
            Pseudo Genes (internal stop)      :: 246 of 1,141
            Pseudo Genes (multiple problems)  :: 167 of 1,141
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..182726
                     /organism="Shigella dysenteriae Sd197"
                     /mol_type="genomic DNA"
                     /strain="Sd197"
                     /serotype="1"
                     /db_xref="taxon:300267"
                     /plasmid="pSD1_197"
     gene            complement(191..>437)
                     /locus_tag="SDY_RS23105"
                     /old_locus_tag="SDY_P002"
                     /pseudo
     CDS             complement(191..>437)
                     /locus_tag="SDY_RS23105"
                     /old_locus_tag="SDY_P002"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611434.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing N-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            <440..>637
                     /locus_tag="SDY_RS23110"
                     /pseudo
     CDS             <440..>637
                     /locus_tag="SDY_RS23110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012471715.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus and C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            <681..>800
                     /locus_tag="SDY_RS23115"
                     /pseudo
     CDS             <681..>800
                     /locus_tag="SDY_RS23115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309413.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing N-terminus and C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3440 domain-containing protein"
     gene            1050..1916
                     /gene="ospB"
                     /locus_tag="SDY_RS23120"
                     /old_locus_tag="SDY_P003"
     CDS             1050..1916
                     /gene="ospB"
                     /locus_tag="SDY_RS23120"
                     /old_locus_tag="SDY_P003"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 3 secretion system effector OspB"
                     /protein_id="WP_001046940.1"
                     /translation="MNLDGVRPYCRIVNKKNESISDIAFAHIIKRVKNSSCTHPKAAL
                     VFLGEKGFCDSNDVLSIMGQQIPRVFKNKMLYDYVFKNEKSKNDFLKMAESWLPQSEP
                     VVINNDDDALNAAAYFSVKKAKIKTVNDTDFKEYNKVYILGHGSPGSHQLGLGSELID
                     VQTIISRMKDCGILNVKDIRFTSCGSADKVAPKDFNNAPAESLSCILNSLPFFKEKES
                     LLEQIKKHLENDESLSDGLKISGYHGYGVHYGQELFPYSHYRSTSIPADPEHTVKRSS
                     QKKTFIINKELD"
     gene            2244..2984
                     /gene="phoN2"
                     /locus_tag="SDY_RS23125"
                     /old_locus_tag="SDY_P004"
     CDS             2244..2984
                     /gene="phoN2"
                     /locus_tag="SDY_RS23125"
                     /old_locus_tag="SDY_P004"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAP2 family phosphatase PhoN2"
                     /protein_id="WP_000850660.1"
                     /translation="MKTKNFLLFCIATNMIFIPSANALKAEGFLTQQTSPDSLSILPP
                     PPAEDSVVFQADKAHYEFGRSLRDANRVRLASEDAYYENFGLAFSDAYGMDISRENTP
                     ILYQLLTQVLQDSHDYAVRNAKEYYKRVRPFVIYKDATCTPDKDEKMAITGSYPSGHA
                     SFGWAVALILAEINPQRKAEILRRGYEFGESRVICGAHWQSDVEAGRLMGASVVAVLH
                     NTPEFTKSLSEAKKEFEELNTPTNELTP"
     gene            complement(3325..>4287)
                     /locus_tag="SDY_RS23130"
                     /pseudo
     CDS             complement(3325..>4287)
                     /locus_tag="SDY_RS23130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858196.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="T3SS effector OspC family protein"
     gene            4364..5058
                     /locus_tag="SDY_RS23135"
     CDS             join(4364..4610,4610..5058)
                     /locus_tag="SDY_RS23135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477181.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
                     /protein_id="WP_134801664.1"
                     /translation="MASVNIHCPRCQSAQVYRHGHNPKGHDRFRCRDCHRVFQLTYTY
                     EACKPGIKELITEMAFNGAGVRDTARTLKIGINTVIRTFKKLTPKRITSSPVAHADVA
                     LICELDEQWSFVGSKARQHWLWYAYNTKTGGVLAYTFGPRTDETCRELLALLTPFNIG
                     MITSDDWGSYGREVTKDKHLTGKIFTQRIERNNLTLRTRIKRLARKTICFSRSVEIHE
                     KVIGTFIEKHMFY"
     gene            complement(<5514..>6032)
                     /locus_tag="SDY_RS23140"
                     /old_locus_tag="SDY_P007"
                     /pseudo
     CDS             complement(<5514..>6032)
                     /locus_tag="SDY_RS23140"
                     /old_locus_tag="SDY_P007"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012904571.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus and C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family transposase zinc-finger binding
                     domain-containing protein"
     gene            complement(<6049..6734)
                     /locus_tag="SDY_RS24515"
                     /pseudo
     CDS             complement(<6049..6734)
                     /locus_tag="SDY_RS24515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611998.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            complement(7424..9133)
                     /locus_tag="SDY_RS23155"
                     /old_locus_tag="SDY_P010"
     CDS             complement(7424..9133)
                     /locus_tag="SDY_RS23155"
                     /old_locus_tag="SDY_P010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858142.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ShET2/EspL2 family type III secretion system
                     effector toxin"
                     /protein_id="WP_024263012.1"
                     /translation="MPLNKTFSSSIFSTKNSLSTDMSVNRDNRTITSSIMRVSNSSEL
                     IQFKNKTAPYFSEKRNVKVNINGVAKDIYGRQIVCRHLASYWEMNFMETNGKVNYQLL
                     STPDAIAKNVCLEKTEDFSKSPAYIYFVENKKWGTVITNFFYNMKKNGDFVRTLSACT
                     LNHQMALGLKIKRVQESEKWVVQFFDPNRTVTHKRTVFTCDSHFELSQLSAKDFFDDF
                     YWKIYGLEQPGQVIFEDRHNSPLTNTVKLLPDELINSRVIYHAITKNLTEVLFILMEK
                     YKNGEISQSKLVNLLATRSSDGTPAFYIALQNGCSDIIQVYGKILNMCNLSQETILSL
                     LAAVGANNVPGLCMSFMNGHVDTIKAYGEIVFKTPLTSDKRLYLLAAKDSHDLPGLFF
                     ALQNGHADSIRMFGSLLNKKMLSSEQIKELLKVKHGLFMALQNGHTKAIMAYGDILKI
                     LPPHQEYIDELLWIKNPNGTSGLFMAFYNGHTETIRAFCNILKNYSFTTRRLVEMLSA
                     TNKDGIPGVFVSVVNRDKETILEYCRIIKENNLEPDTIAEQFSKKIKKTFIEIINRFN
                     HFL"
     gene            complement(9498..10726)
                     /locus_tag="SDY_RS23160"
                     /old_locus_tag="SDY_P011"
     CDS             complement(join(9498..10411,10411..10726))
                     /locus_tag="SDY_RS23160"
                     /old_locus_tag="SDY_P011"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_086558215.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-like element IS2 family transposase"
                     /protein_id="WP_164833015.1"
                     /translation="MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAAS
                     QLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVE
                     YGRGKKVDSARALIARGWGVSLVSRCLRVSRAQLHVILRRTDDWMDGRRSRHTDDTDV
                     LLRIHHVIGELPTYGYRRVWALLRRQAELNGMPAINAKRVYRIMRQNALLLERKPAVP
                     PSKRAHTGRVAVKESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFN
                     SETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRS
                     PESNGIAESFVKTIKRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPRGY
                     LRQRACNGLSDNRCLEI"
     gene            complement(10901..11620)
                     /locus_tag="SDY_RS23165"
                     /old_locus_tag="SDY_P013"
     CDS             complement(10901..11620)
                     /locus_tag="SDY_RS23165"
                     /old_locus_tag="SDY_P013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system effector
                     phosphothreonine lyase"
                     /protein_id="WP_001121864.1"
                     /translation="MPIKKPCLKLNLDSLNVVRSEIPQMLSANERLKNNFNILYNQIR
                     QYPAYYFKVASNVPNYSDICQFFSVMYQGFQIVNHSGDVFIHACRENPQSKGDFVGDK
                     FHISIAREQVPLAFQILSGLLFSEDSPIDKWKITDMNRVSQQSRVGIGAQFTLYVKSD
                     QECSQYSALLLHKIRQFIMCLESNLLRSKIAPGEYPASDVRPEDWKYVSYRNELRSDR
                     NGSERQEQMLREEPFYRLMIE"
     gene            complement(11826..>12389)
                     /locus_tag="SDY_RS23170"
                     /old_locus_tag="SDY_P014"
                     /pseudo
     CDS             complement(11826..>12389)
                     /locus_tag="SDY_RS23170"
                     /old_locus_tag="SDY_P014"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000343760.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            <12385..12631
                     /locus_tag="SDY_RS23175"
                     /pseudo
     CDS             <12385..12631
                     /locus_tag="SDY_RS23175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611146.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            complement(12740..13318)
                     /locus_tag="SDY_RS23180"
                     /old_locus_tag="SDY_P015"
     CDS             complement(12740..13318)
                     /locus_tag="SDY_RS23180"
                     /old_locus_tag="SDY_P015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000868555.1"
                     /translation="MKVSFKPLGYIFHDIYNKKHTIDEFNDVVRKAVLSGKINELNAC
                     HKVAIFLAEKDNEITKKDKAKIIDTLTENYSIEFQQLMNISERTLNSSLYITPGESGF
                     VSFVNREGKICHTAYVKSSDNSMAYYHANGSSIDKYITDMCGLICMRHIDSTGIIFYM
                     LDEKVLSAIAEFMNEKGWRAAFCSAKNLYKCV"
     gene            complement(13744..>13981)
                     /locus_tag="SDY_RS24520"
                     /pseudo
     CDS             complement(13744..>13981)
                     /locus_tag="SDY_RS24520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001775081.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
     gene            complement(14168..>14597)
                     /locus_tag="SDY_RS23190"
                     /old_locus_tag="SDY_P018"
                     /pseudo
     CDS             complement(14168..>14597)
                     /locus_tag="SDY_RS23190"
                     /old_locus_tag="SDY_P018"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013747467.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing N-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            14675..14962
                     /locus_tag="SDY_RS23195"
                     /old_locus_tag="SDY_P017"
     CDS             14675..14962
                     /locus_tag="SDY_RS23195"
                     /old_locus_tag="SDY_P017"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001082153.1"
                     /translation="MNRTAFRAIHAVGADTGRNCRKFLPVSAGNFRIPFVINTYKPED
                     QFFVSGIHKERNIQVCATLNGIVKIIKAQNLSFFVTGSFKPSGLFPPAPQK"
     gene            14993..15640
                     /locus_tag="SDY_RS23200"
                     /pseudo
     CDS             14993..15640
                     /locus_tag="SDY_RS23200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001355812.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            15640..15987
                     /gene="tnpB"
                     /locus_tag="SDY_RS23205"
                     /old_locus_tag="SDY_P020"
     CDS             15640..15987
                     /gene="tnpB"
                     /locus_tag="SDY_RS23205"
                     /old_locus_tag="SDY_P020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000624623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family insertion sequence element accessory
                     protein TnpB"
                     /protein_id="WP_000622997.1"
                     /translation="MISFPAGSRIWLVAGITDMRNGFNGLASKVQNVLKDDPFSGHLF
                     IFRGRRSDQIKVLWADSDGLCLFTRRLERGRFVWPVTRDGKVHLTPAQLSMLLEGIDW
                     KHPKRTERAGIRI"
     gene            16007..>17236
                     /locus_tag="SDY_RS23210"
                     /old_locus_tag="SDY_P021"
                     /pseudo
     CDS             16007..>17236
                     /locus_tag="SDY_RS23210"
                     /old_locus_tag="SDY_P021"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012904571.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family transposase"
     gene            <17240..>17399
                     /locus_tag="SDY_RS23215"
                     /pseudo
     CDS             <17240..>17399
                     /locus_tag="SDY_RS23215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477168.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus and C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            17988..>18286
                     /locus_tag="SDY_RS23220"
                     /old_locus_tag="SDY_P022"
                     /pseudo
     CDS             17988..>18286
                     /locus_tag="SDY_RS23220"
                     /old_locus_tag="SDY_P022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000343747.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            <18368..18505
                     /locus_tag="SDY_RS23225"
                     /pseudo
     CDS             <18368..18505
                     /locus_tag="SDY_RS23225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011787828.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS630 family transposase"
     gene            18877..19554
                     /gene="ospD1"
                     /locus_tag="SDY_RS23230"
                     /old_locus_tag="SDY_P023"
     CDS             18877..19554
                     /gene="ospD1"
                     /locus_tag="SDY_RS23230"
                     /old_locus_tag="SDY_P023"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 3 secretion system effector OspD1"
                     /protein_id="WP_011379050.1"
                     /translation="MSINNYGLHPANNKNMHLIIGSNTANENKGIRSNIINVTNSAIS
                     HAINEEKSGGGYSGVFFRKLAKIQSISIPTKNNKEYNRHNLFSLIWHGNADAARKYGE
                     SLLAAEIPKEEKLEVLAARNNAGESALFIALQEGHSAAIQAYGDFIKTFDLSPKETIK
                     LLDVRDNEGLPGLFLAAGRGNIEAMMAYINICHHSGIKLTEIADRLNNNEQDMFNIIS
                     DKIQELF"
     gene            20066..20380
                     /locus_tag="SDY_RS23240"
     CDS             20066..20380
                     /locus_tag="SDY_RS23240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011114726.1"
                     /translation="MLQRQRGKVGFAQLPVDFVAIEPDSVQGVGKRANLTNRCFIIRI
                     NDSFKKRQGFIEFISNSGSGHTVTVYTKRRFQRGVFMNSLNTNVVKPVMYRLRSSADA
                     RP"
     gene            20662..21228
                     /gene="ipgB2"
                     /locus_tag="SDY_RS23245"
                     /old_locus_tag="SDY_P025"
     CDS             20662..21228
                     /gene="ipgB2"
                     /locus_tag="SDY_RS23245"
                     /old_locus_tag="SDY_P025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858157.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion effector IpgB2"
                     /protein_id="WP_024263014.1"
                     /translation="MLGTSFNNFGISLSHKRYFSGKVDEIIRCTMGKRIVKISSTKIN
                     TSILSSVSEQIGENITDWKNDEKKVYVSRVVNQCIDKFCAEHSREIGDNLRKQIFKQV
                     EKDYRISLDINAAQSSINHLVSGSSYFKKKMDELCEGMNRSVKNDTTSNVVNLISDQF
                     FEKNVQYIDLKKLRGNMSDYITNLESPF"
     gene            complement(21433..21549)
                     /locus_tag="SDY_RS23250"
                     /pseudo
     CDS             complement(21433..21549)
                     /locus_tag="SDY_RS23250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004989794.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase domain-containing protein"
     gene            21800..22965
                     /locus_tag="SDY_RS23260"
                     /old_locus_tag="SDY_P027"
     CDS             join(21800..22061,22061..22965)
                     /locus_tag="SDY_RS23260"
                     /old_locus_tag="SDY_P027"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477168.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-like element IS3H family transposase"
                     /protein_id="WP_134801821.1"
                     /translation="MTKTVSTSKKTRKQHSPEFCSEALKLAERIGVAAAARELSLYES
                     QLYAWRSKLQQQMTSSERESELAAENARLKRQLAEQAEELAILPKGRDILCEAPEMKY
                     VFIEKHQAEFSIKAMCRVLRVARSGWYTWCQRRTGISPRQQFCQHCDSVVLAAAFTRS
                     KQRYGAPRLTDELRAQGYHFNVKTVAASLRRQGLRAKGSRKFSPVSYRAHGLPVSENL
                     LEQDFYASGPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRLTAQLACDA
                     LQMALWRRKRPRNVIVHSDRGSQYCSADYQALLKWHNLRGSMSAKGCCYDNACVESFF
                     HSLKVECLHGEHFISREIMWATVFNYIECDYNRWRRHSWCGGLSPEQFENQNLA"
     gene            23305..>23666
                     /locus_tag="SDY_RS23265"
                     /old_locus_tag="SDY_P028"
                     /pseudo
     CDS             23305..>23666
                     /locus_tag="SDY_RS23265"
                     /old_locus_tag="SDY_P028"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477181.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            23753..24763
                     /locus_tag="SDY_RS23270"
                     /old_locus_tag="SDY_P029"
                     /pseudo
     CDS             23753..24763
                     /locus_tag="SDY_RS23270"
                     /old_locus_tag="SDY_P029"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000627495.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS21 family transposase"
     gene            24760..25541
                     /locus_tag="SDY_RS23275"
                     /old_locus_tag="SDY_P030"
                     /pseudo
     CDS             24760..25541
                     /locus_tag="SDY_RS23275"
                     /old_locus_tag="SDY_P030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858162.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
     gene            <25608..25946
                     /locus_tag="SDY_RS23280"
                     /pseudo
     CDS             <25608..25946
                     /locus_tag="SDY_RS23280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477181.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            26268..27467
                     /locus_tag="SDY_RS23285"
                     /old_locus_tag="SDY_P031"
     CDS             26268..27467
                     /locus_tag="SDY_RS23285"
                     /old_locus_tag="SDY_P031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_000200286.1"
                     /translation="MTSFEQLSKVAQRADKMLLALTKQIQEQKQEFQADVFYQVYSKS
                     AVAKLPKLTRASVDGAVGEMEAQGYQFEKRPAGTATKYALTIQNIIDIYAHRGIPKYR
                     DRYSEAYSIFIGSLKGGVSKTVSSVSVAHALRAHPHLLSEDLRILLLDLDPQSSATMF
                     LNYLHAVGLVDTTAPQAMLQNVSREELLEDFIVPSVIPGVYVMPASIDDAFIASNWDT
                     LCEEHLLGQNKHAILRENIIDKLKHDFDFILIDTGPHLDAFLKNAIAAADIMFTPVPP
                     AQVDFHSTLKYLARLPELVQIIEQDGCSCRLQANIGFMSKLANKSDHKYCHSLTKEIF
                     GGDMLDVSMPRLDGFERSGESFDTVISANPVTYVGSGEALKNARMAAEAFAKAVFDRI
                     EFIRANY"
     gene            27467..28447
                     /locus_tag="SDY_RS23290"
                     /old_locus_tag="SDY_P032"
     CDS             27467..28447
                     /locus_tag="SDY_RS23290"
                     /old_locus_tag="SDY_P032"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParB/RepB/Spo0J family partition protein"
                     /protein_id="WP_000431558.1"
                     /translation="MENRKHRPTIGRTLNTNILNNTEEISAPVHVFTLNTGRKAKFTE
                     IKVDHDKVDTQTFVVEEVNGREQTALTPDSLKDITRTIRLQQFYPCIGIRTGDLIEIL
                     DGSRRRAAALLCKVGLRVLVTDDELTVSEAQHLAKDLQTSLEHNIREIGLRLVRLKEA
                     GMNQKQIAEREGLSAAKVTRALQAASVPKDFVSLFPVQSELTYADYRQLAELSERLRL
                     GDISIDEVVKNISPSIELITADDNLSEDEVKNSIMRLITKEMSSLLDSGVKDKAVVTL
                     LWKFDSKDKFARKRVKGRTFSYEFGRLPLEVQDKLDRMIALVLKDNLNSL"
     gene            28703..>29185
                     /locus_tag="SDY_RS23295"
                     /old_locus_tag="SDY_P033"
                     /pseudo
     CDS             28703..>29185
                     /locus_tag="SDY_RS23295"
                     /old_locus_tag="SDY_P033"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016154415.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
     gene            complement(29215..>29394)
                     /locus_tag="SDY_RS23300"
                     /pseudo
     CDS             complement(29215..>29394)
                     /locus_tag="SDY_RS23300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012904571.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase domain-containing protein"
     gene            complement(29477..30709)
                     /gene="ltrA"
                     /locus_tag="SDY_RS23305"
                     /old_locus_tag="SDY_P034"
     CDS             complement(29477..30709)
                     /gene="ltrA"
                     /locus_tag="SDY_RS23305"
                     /old_locus_tag="SDY_P034"
                     /EC_number="2.7.7.49"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012601335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="group II intron reverse transcriptase/maturase"
                     /protein_id="WP_128876770.1"
                     /translation="MQRKSFEIPKALVWASYLDVRRNKGAPGCDGQTLKMFDQQRDGN
                     LYKIWNRLCSGTWFPPPVLEKRIPKSNGKERILGIPTVSDRIAQGAIKLFMEEKLDPI
                     FHADSYGYRPGKSAHDALKQCAIRCWRYSWILEVDISAFFDHVRHDLVLKALEHHGMP
                     KWVILYCRRWMEAPMQSCENGEVITRTRGTPQGGVISPLLANLFLHYAFDLWMEREYR
                     GVPFERYADDIVVHCSRMSDATRLKNRLSERFSEVGLVLNAGKTNTAYIDTFKRRNVA
                     TSFTFLGYDFKVRTLKNFKGERYRKCMPGASNAAMRKITETIKKWRIHRSTAESLLDF
                     ARRYNAIVRGWIEYYGKFWSRNFNYRLWSAMQSRLLKWMQSKYRLSNRKAQRKLTLVR
                     KEDPKLFVHWYLLRASNE"
     gene            complement(<31180..>31359)
                     /locus_tag="SDY_RS23315"
                     /pseudo
     CDS             complement(<31180..>31359)
                     /locus_tag="SDY_RS23315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012904571.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus and C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(31384..32605)
                     /locus_tag="SDY_RS23320"
                     /pseudo
     CDS             complement(31384..32605)
                     /locus_tag="SDY_RS23320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_086558238.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     misc_feature    complement(32208..32324)
                     /locus_tag="SDY_RS23320"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF01497"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="AL1L pseudoknot; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /pseudo
                     /db_xref="RFAM:RF01497"
     gene            complement(32657..34381)
                     /gene="ipaH4.5"
                     /locus_tag="SDY_RS23325"
                     /old_locus_tag="SDY_P037"
     CDS             complement(32657..34381)
                     /gene="ipaH4.5"
                     /locus_tag="SDY_RS23325"
                     /old_locus_tag="SDY_P037"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T3SS effector E3 ubiquitin-protein ligase
                     IpaH4.5"
                     /protein_id="WP_011379044.1"
                     /translation="MKPINNHSFFRSLCGLSCISRLSVEEQCTRDYHRIWDDWAREGT
                     TTENRIQAVRLLKICLDTREPVLNLSLLKLRSLPPLPLHIRELNISNNELISLPENSP
                     LLTELHVNGNNLNILPTLPSQLIKLNISFNRNLSCLPSLPPYLQSLSARFNSLETLPE
                     LPSTLTILRIEGNRLTVLPELPHRLQELFVSGNRLQELPEFPQRLKYLKVGENQLRRL
                     SRLPQELLALDVSNNLLTSLPENIITLPICTNVNISGNPLSTRVLQSLQRLTSSPDYH
                     GPQIYFSMSDGQQNTLHRPLADAVTAWFPENKQSDISQIWHAFEHEEHANTFSAFLDR
                     LSDTVSARNTSGFREQVAAWLEKLSASAELRQQSFAVAADATESCEDRVALTWNNLRK
                     TLLVHQASEGLFDNDTGALLSLGREMFRLEILEDIARDKVRTLHFVDEIEVYLAFQTM
                     LAEKLQLSTAVKEMRFYGVSGVTANDLRTAEATVRSREENEFTDWFSLWGPWHAVLKR
                     TEADRWAQAEEQKYEMLENEYSQRVADRLKASGLSGDADAEREAGAQVMRETEQQIYR
                     QLTDEVLA"
     gene            complement(34809..36506)
                     /gene="ipaH7.8"
                     /locus_tag="SDY_RS23330"
                     /old_locus_tag="SDY_P038"
     CDS             complement(34809..36506)
                     /gene="ipaH7.8"
                     /locus_tag="SDY_RS23330"
                     /old_locus_tag="SDY_P038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T3SS effector E3 ubiquitin-protein ligase
                     IpaH7.8"
                     /protein_id="WP_011379043.1"
                     /translation="MFSVNNTHSSVSCSPSINSNLTSNEHYLRILTEWEKNSSPGEER
                     GIAFNRLSQCFQNQEAVLNLSDLNLTSLPELPKHISALIVENNKLTSLPKLPAFLKEL
                     NADNNRLSVIPELPESLTTLSVRSNQLENLPVLPNHLTSLFVENNRLYNLPALPEKLK
                     FLHVYYNRLTTLPDLPDKLEILCAQRNNLVTFPQFSDRNNIRQKEYYFHFNQITTLPE
                     SFSQLDSSYRINISGNPLSTRVLQSLQRLTSSPDYHGPQIYFSMSDGQQNTLHRPLAD
                     AVTAWFPENKQSDISQIWHAFEHEEHANTFSAFLDRLSDTVSARNTSGFREQVAAWLE
                     KLSASAELRQQSFAVAADATESCEDRVALTWNNLRKTLLVHQASEGLFDNDTGALLSL
                     GREMFRLEILEDIARDKVRTLHFVDEIEVYLAFQTMLAEKLQLSTAVKEMRFYGVSGV
                     TANDLRTAEATVRSREENEFADWFSLWGPWHAVLKRTEADRWAQAEEQKYEMLENEYS
                     QRVADRLKASGLSGDADAEREAGAQVMRETEQQIYRQLTDEVLALRLSENGSRLHHS"
     gene            <36836..>37015
                     /locus_tag="SDY_RS23335"
                     /pseudo
     CDS             <36836..>37015
                     /locus_tag="SDY_RS23335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611684.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus and C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(37032..>37281)
                     /locus_tag="SDY_RS23340"
                     /pseudo
     CDS             complement(37032..>37281)
                     /locus_tag="SDY_RS23340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477181.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            complement(37326..>38220)
                     /locus_tag="SDY_RS23345"
                     /pseudo
     CDS             complement(37326..>38220)
                     /locus_tag="SDY_RS23345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611998.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            complement(38236..38933)
                     /locus_tag="SDY_RS23350"
                     /pseudo
     CDS             complement(38236..38933)
                     /locus_tag="SDY_RS23350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612230.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            39246..40090
                     /locus_tag="SDY_RS23355"
     CDS             join(39246..39588,39588..40090)
                     /locus_tag="SDY_RS23355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611198.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS5 family transposase"
                     /protein_id="WP_094096542.1"
                     /translation="MARYDLPDEAWTIIKPLLPPEPATPRAGRPWAEHRKIINGMFWV
                     LCSGAPWRDLPERYGAWKTVYNRFNRWSKSGVINIIFNRLLSLLDANGFIDWSATALD
                     GSNIRALKCAAGGSKKHPDIDGDNGPGRSRGGFGTKIHLATDGSGLPLNIVLSPGQAH
                     ESQFAQRLLDGIGVQRQNGSMKRRGHAVLADKAYSGRALRNELKNNGIKAVIPRKSNE
                     KMASDGRAQLDRDAYRNRNVVERCFGRLKEYRRIATRYDKTARNYLAMVKLGCIRLFY
                     QRLRN"
     gene            40229..>40384
                     /locus_tag="SDY_RS23360"
                     /old_locus_tag="SDY_P044"
                     /pseudo
     CDS             40229..>40384
                     /locus_tag="SDY_RS23360"
                     /old_locus_tag="SDY_P044"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000343613.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS256 family transposase"
     gene            complement(40414..42141)
                     /locus_tag="SDY_RS23365"
                     /old_locus_tag="SDY_P045"
     CDS             complement(40414..42141)
                     /locus_tag="SDY_RS23365"
                     /old_locus_tag="SDY_P045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858398.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="E3 ubiquitin--protein ligase"
                     /protein_id="WP_024263018.1"
                     /translation="MIKSTNIQAIGSGIMHQINNIYSLTPFSSPMELTPSCNEFYLKA
                     WSEWEKNGTPGEQRNIAFNRLKICLQNQEAELNLSELDLKTLPDLPPQITTLEIRKNL
                     LTHLPDLPPMLKVIHAQFNQLESLPALPETLEELNAGDNKIKELPFLPENLTHLRVHN
                     NRLHILPLLPPELKLLVVSGNRLDSIPPFPDKLEGLALANNFIEQLPELPFSMNRAVL
                     MNNNLTTLPESVLRLAQNAFVNVAGNPLSGHTMRTLQQITTGPDYSGPRIFFSMGNSA
                     TISAPEHSLADAVTAWFPENKQSDVSQIWHAFEHEEHANTFSAFLDRLSDTVSARNTS
                     GFREQVAAWLEKLSASAELRQQSFAVAADATESCEDRVALTWNNLRKTLLVHQASEGL
                     FDNDTGALLSLGREMFRLEILEDIARDKVRTLHFVDEIEVYLAFQTMLAEKLQLSTAV
                     KEMRFYGVSGVTANDLRTAEATVRSREENEFTDWFSLWGPWHAVLKRTEADRWAQAEE
                     QKYEMLENEYSQRVADRLKASGLSGDADAEREAGAQVMRETEQQIYRQLTDEVLALRL
                     SENGSNHIA"
     gene            complement(42529..42795)
                     /gene="ospE2"
                     /locus_tag="SDY_RS23370"
                     /old_locus_tag="SDY_P046"
     CDS             complement(42529..42795)
                     /gene="ospE2"
                     /locus_tag="SDY_RS23370"
                     /old_locus_tag="SDY_P046"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_001449236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 3 secretion system effector OspE2"
                     /protein_id="WP_000957712.1"
                     /translation="MLTQTIFPCLPQKQENIILEVSNPVLLSSTVTTDGYTVFNKKAA
                     IYELQIPAANRTKTLKFTATEMQWLTKINEAGIDEKQSQRYSDF"
     gene            complement(42903..43126)
                     /locus_tag="SDY_RS23375"
                     /old_locus_tag="SDY_P047"
                     /pseudo
     CDS             complement(42903..43126)
                     /locus_tag="SDY_RS23375"
                     /old_locus_tag="SDY_P047"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477181.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(43442..43594)
                     /locus_tag="SDY_RS23380"
     CDS             complement(43442..43594)
                     /locus_tag="SDY_RS23380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858399.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011114782.1"
                     /translation="MSVKLRLPQLSSGEYLPGSLQDKILSDDCLEKEQMVVSAIASTP
                     QASYHI"
     gene            43633..>44069
                     /locus_tag="SDY_RS23385"
                     /old_locus_tag="SDY_P048"
                     /pseudo
     CDS             43633..>44069
                     /locus_tag="SDY_RS23385"
                     /old_locus_tag="SDY_P048"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611998.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(44084..44778)
                     /locus_tag="SDY_RS23390"
     CDS             complement(join(44084..44532,44532..44778))
                     /locus_tag="SDY_RS23390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477181.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
                     /protein_id="WP_134802015.1"
                     /translation="MASVNIHCPRCQSAQVYRHGQNPKGHDRFRCRDCHRVFQLTYTY
                     EARKPGIKELITEMAFNGAGVRDTARTLKIGINTVIRTFKKLTPKRITSSPVAHADVA
                     LICELDEQWSFVGSKARQHWLWYAYNTKTGGGLAYTFGPRTDETCRELLALLTPFNIR
                     MITSDDWGSYGREVPKDKHLTGKIFTQRIERNNLTLRTRIKRLARKTICFSRSVEIHE
                     KVIGTFIEKHMFY"
     gene            complement(44973..46182)
                     /locus_tag="SDY_RS23395"
                     /pseudo
     CDS             complement(44973..46182)
                     /locus_tag="SDY_RS23395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_086558238.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     misc_feature    complement(45785..45901)
                     /locus_tag="SDY_RS23395"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF01497"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="AL1L pseudoknot; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /pseudo
                     /db_xref="RFAM:RF01497"
     gene            complement(<46229..46786)
                     /locus_tag="SDY_RS23400"
                     /pseudo
     CDS             complement(<46229..46786)
                     /locus_tag="SDY_RS23400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000878026.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
     gene            47797..49209
                     /gene="ospC1"
                     /locus_tag="SDY_RS23405"
                     /old_locus_tag="SDY_P055"
     CDS             47797..49209
                     /gene="ospC1"
                     /locus_tag="SDY_RS23405"
                     /old_locus_tag="SDY_P055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 3 secretion system effector OspC1"
                     /protein_id="WP_011379035.1"
                     /translation="MNISEILNSSNTQCNIDSMDNRLHTLFPKVTSVRNAAQQTMPDE
                     KCLKDSANIIKDFFRKTIAAQSYSRMFSQGSNFKSLNIAIDAPSDAKASFKAIEHLDR
                     LSKHYISEIRKKLHPLSAKELNLLSLIINSDLIFRHQSNSDLSDKILNIKSFNKIQSE
                     GICTNRNTYADDIKKIANHDFVFFGVEISSHQKKHPLNTKHHTVDFGANAYMIEHSSP
                     YGYMTLTDHFDNVIPFAQYHEHQSFLDKFSEVNEEVSRYVHGSKGIIDVPIFNTKDMK
                     LGLGLYLIDFIRKSEDQSFKEFCYEKNLSPVDLDRIINFVFQPEYHIPRMVSTENFKK
                     VKIREISLEEAVTASNYEEINKQVTNKKIALQALFFSITNKKEDVALYILSNFEITKQ
                     DVISIKHELYDIEYLLSAHNSSCKVLEYFINKGLVDVNTKFKKTNSGDCMLDNAIKYE
                     NAEMIKLLLKYGATSDNKYI"
     gene            complement(<49308..49442)
                     /locus_tag="SDY_RS23410"
                     /pseudo
     CDS             complement(<49308..49442)
                     /locus_tag="SDY_RS23410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611146.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            49518..51215
                     /gene="ospD3"
                     /locus_tag="SDY_RS23415"
                     /old_locus_tag="SDY_P056"
     CDS             49518..51215
                     /gene="ospD3"
                     /locus_tag="SDY_RS23415"
                     /old_locus_tag="SDY_P056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system effector OspD3"
                     /protein_id="WP_005015229.1"
                     /translation="MPSVNLIPSRKICLQNMINKDNVSVETIQSLLHSKQLPYFSDKR
                     SFLLNLNCQVTDLSGRLIVCRHLASYWIAQFNKSSGHVDYHHFAFPDEIKNYVSVSEE
                     EKAINVPGIIYFVENGSWGDIIYHIFNEMIFHAEKNRALEISTSNHNMALGLKIKETK
                     NGGRFVIQLYDPNHTATHLRAEFNNFNLDKIKKLTVDNFLDEKHQECYGLISDGMSIF
                     VDRHTPTSMSSIIRWPNNLLHPKVIYHAMRMGLTELIQKVTRVVQLSDLSDNTLELLL
                     AAKNDDGLSGLLLALQNGHSDTILAYGELLETSGLNLDKTVELLTAEGMGGRISGLSQ
                     ALQNGHAETIKTYGGLLKKRAINIEYNKLKNLLTAYYYDEVHRQTPGLMFALQNGHAD
                     AIRAYGELILSLPFLNSEDIVNLLASRRYDNVPGLLLALNNGQADAILAYGDILNEAK
                     LNLDKKAELLAAKDSNGLSGLFVALHNGRVETIIAYGKILHTADLTPHQASKLLAAEG
                     PNGVSGLIIAFQNRNFEAIKTYMEIIKDENITPEEIAEHLDKKNGSDFLEIMSNIKS"
     gene            complement(51512..52206)
                     /locus_tag="SDY_RS23420"
     CDS             complement(join(51512..51960,51960..52206))
                     /locus_tag="SDY_RS23420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477181.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS1-like element IS1N family transposase"
                     /protein_id="WP_087786203.1"
                     /translation="MASVNIHCPRCQSAQVYRHGQNPKGHDRFRCRDCHRVFQLTYTY
                     EARKPGIKELITEMAFNGAGVRDTARTLKIGINTVIRTFKKLTPKRITSSPVAHADVA
                     LICELDEQWSFVGSKARQHWLWYAYNTKTGGVLAYTFGPRTDETCRELLALLTPFNIG
                     MITSDDWGSYGREVPKDKHLTGKIFTQRIERNNLTLRTRIKRLARKTICFSRSVEIHE
                     KVIGTFIEKHMFY"
     gene            52421..>53127
                     /locus_tag="SDY_RS23425"
                     /pseudo
     CDS             52421..>53127
                     /locus_tag="SDY_RS23425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015869530.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS256 family transposase"
     gene            53106..>53447
                     /locus_tag="SDY_RS23430"
                     /old_locus_tag="SDY_P061"
                     /pseudo
     CDS             53106..>53447
                     /locus_tag="SDY_RS23430"
                     /old_locus_tag="SDY_P061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000244358.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS4 family transposase"
     gene            53488..>53655
                     /locus_tag="SDY_RS23435"
                     /pseudo
     CDS             53488..>53655
                     /locus_tag="SDY_RS23435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001608690.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            53721..54934
                     /locus_tag="SDY_RS23440"
                     /old_locus_tag="SDY_P062"
                     /pseudo
     CDS             53721..54934
                     /locus_tag="SDY_RS23440"
                     /old_locus_tag="SDY_P062"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_086558238.1"
                     /note="programmed frameshift; internal stop; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     misc_feature    54002..54118
                     /locus_tag="SDY_RS23440"
                     /old_locus_tag="SDY_P062"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF01497"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="AL1L pseudoknot; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /pseudo
                     /db_xref="RFAM:RF01497"
     gene            55275..56927
                     /locus_tag="SDY_RS23445"
                     /old_locus_tag="SDY_P064"
     CDS             55275..56927
                     /locus_tag="SDY_RS23445"
                     /old_locus_tag="SDY_P064"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858318.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional UDP-sugar
                     hydrolase/5'-nucleotidase"
                     /protein_id="WP_000612524.1"
                     /translation="MIPLKKNITLIMFTLSLLTGNPAIAYETDKVYKITVLHTNDHHG
                     HFWRNNHGEYGLSSQKTLVDNIRQKVINNGGSVLLLSGGDINTGVPESDLQKAEPDIR
                     GMNLIGYDAMAVGNHEFDNPLNILRQQEKWATFPFLSANIYQKSTGRRLFSPWKIFIR
                     QNLKIAVIGLTTDDTAKTGNSEYFTDIEFRQPAAEARSVIDELNQQEKPDIIIAATHM
                     GHYDNGESGSNAPGDVEMARSLPTGSLAMIVGGHSQAPVCMASDNKKQWNYIPGTTCV
                     PDKQNGIWIVQAHEWGKYVGQADFEFCNGTMKLVNYQLHPVNLKMRITREDGKTEFSF
                     YTPEITEDPQMLSLLTPFQNKGKAQLDVKVGVVNGRLEGDRSKVRFVQTSMGHLILSA
                     LTERIDADFAVVSGGEIRDSIESGNITYKDILKVQPFGNTVVSIDLTGKEVADYLATV
                     AQMKPDSGAYPQFLNTSFVVKKGKIEMLKIKGKSVDLNKKYRMTTFSFNATGGDGYPR
                     IDNRPGYINTGFIDAEVLIEYIREHSPLDAASYEPKGEVSWQ"
     gene            56996..57690
                     /locus_tag="SDY_RS23450"
     CDS             join(56996..57242,57242..57690)
                     /locus_tag="SDY_RS23450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477181.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
                     /protein_id="WP_134801584.1"
                     /translation="MASVNIHCPRCQSAQVYRHGQNPKGHDRFRCRDCHRVFQLTYTY
                     EARKPGIKELITEMAFNGAGVCDTARTLKIGINTVIRTFKKLTPKRITSSPVAHADVA
                     LICELDEQWSFVGSKARQHWLWYAYNTKTGGVLAYTFGPRTDETCRELLALLTPFNIG
                     MITSDDWGSYGREVPKDKHLTGKIFTQRIERNNLTLRTRIKRLARKTICFSRSVEIHE
                     KVIGTFIEKHMFY"
     gene            58105..58854
                     /locus_tag="SDY_RS23455"
                     /old_locus_tag="SDY_P067"
     CDS             58105..58854
                     /locus_tag="SDY_RS23455"
                     /old_locus_tag="SDY_P067"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase PAP2 family protein"
                     /protein_id="WP_000828660.1"
                     /translation="MKRQLFTLSIVGVFSLNTFASFPPGNDVTTKPDLYYLTNDNAID
                     SLALLPPPPQIGSIAFLNDQAMYEKGLLLRNTERGKLAAEDANLSSGGVANVFSAAFG
                     SPITAKDSPELHKLLTNMIEDAGDLATRSAKEYYMRIRPFAFYGVSTCNTKEQDTLSR
                     NGSYPSGHTSIGWATALVLSEINPARQDTILKRGYELGDSRVICGYHWQSDVDAARIV
                     GSAIVATLHSNPVFQAQLQKAKDEFANNQKK"
     gene            complement(59024..59868)
                     /locus_tag="SDY_RS23460"
                     /pseudo
     CDS             complement(59024..59868)
                     /locus_tag="SDY_RS23460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611198.1"
                     /note="programmed frameshift; internal stop; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS5 family transposase"
     gene            60293..61747
                     /gene="ospC2"
                     /locus_tag="SDY_RS23465"
                     /old_locus_tag="SDY_P070"
     CDS             60293..61747
                     /gene="ospC2"
                     /locus_tag="SDY_RS23465"
                     /old_locus_tag="SDY_P070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 3 secretion system effector OspC2"
                     /protein_id="WP_000701102.1"
                     /translation="MKIPEAVNHINVQNNIDLVDGKINPNKDTKALQKNISCVTNSSS
                     SGISEKHLDHCADTVKSFLRKSIAAQSYSKMFSQGTSFKSLNLSIEAPSGARSSFRSL
                     EHLDKVSRHYLSEIIQKTHPLSSDERHFLSIIINSDFNFRHQSNANLSNNTLNIKSFD
                     KIKSENIQTYKNTFSEDIEEIANHDFVFFGVEISNHQETLPLNKTHHTVDFGANAYII
                     DHDSPYGYMTLTDHFDNAIPPVFYHEHQSFFLDNFKEVVDEVSRYVHGNQGKTDVPIF
                     NTKDMRLGIGLHLIDFIRKSKDQRFREFCYNKNIDPVSLDRIINFVFQPEYHIPRMLS
                     TDNFKKIRLRDISLEDAIKASNYEEINNKVTDKKMAHQALAYSLGNAKSDMALYLLSK
                     FNFTKQDVAEMEKMNNNMYCELYDVEYLLSEDSANYKVLEYFINNGLVDVNKRFQKAN
                     SGDTMLDNAMKSKDSKTIDFLLKNGAVSGKRFGR"
     gene            complement(61897..62741)
                     /locus_tag="SDY_RS23470"
     CDS             complement(join(61897..62399,62399..62741))
                     /locus_tag="SDY_RS23470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611198.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS5 family transposase"
                     /protein_id="WP_134802192.1"
                     /translation="MARYDLPDEAWTIIKPLLPPEPATPRAGRPWAEHRKIINGMFWV
                     LCSGAPWRDLPERYGAWKTVYNRFNRWSKSGVINIIFNRLLSLLDANGFIDWSATALD
                     GSNIRALKCAAGGSKKHPDIDGDNGPGRSRGGFGTKIHLATDGSGLPLNIVLSPGQAH
                     ESQFAQRLLDGIGVQRQNGSMKRRGHAVLADKAYSGRTLRNKLKNNGIKAVIPRKSNE
                     KMASDGRAQLDRDAYCNRNVVERCFGRLKEYRRIATRYDKTARNYLAMVKLGCIRLFY
                     QRLRN"
     gene            complement(62787..63167)
                     /locus_tag="SDY_RS23475"
                     /old_locus_tag="SDY_P073"
     CDS             complement(62787..63167)
                     /locus_tag="SDY_RS23475"
                     /old_locus_tag="SDY_P073"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858326.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system RelB/DinJ family
                     antitoxin"
                     /protein_id="WP_005015412.1"
                     /translation="MTMATINARIDDDIKNQADEVLKLMNISQTQAIAAFYQYITEQK
                     KLPFVITSIVKTPHDLLRESTDMLAEALAVISNLQVWTEQQDGIGKAKLMEYYRRLDA
                     LYCCAKEKIGLLSDNRDAELGCVP"
     gene            complement(63347..63742)
                     /locus_tag="SDY_RS23480"
                     /old_locus_tag="SDY_P074"
     CDS             complement(63347..63742)
                     /locus_tag="SDY_RS23480"
                     /old_locus_tag="SDY_P074"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning/stability family protein"
                     /protein_id="WP_000445931.1"
                     /translation="MESSDPKKRKKVVAYLHPALYPQDNLTQQTIDSLPVQMRGDFYR
                     QSLICGAALYSVDPRLLTLISGFFSEKITAENLVKLIEQTTGYTSTSIDISVLKNIIE
                     ASSENKSESITSKDDFEEQTRRNLSMLKK"
     gene            complement(63742..64701)
                     /locus_tag="SDY_RS23485"
                     /old_locus_tag="SDY_P075"
     CDS             complement(63742..64701)
                     /locus_tag="SDY_RS23485"
                     /old_locus_tag="SDY_P075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid segregation protein ParM"
                     /protein_id="WP_000921950.1"
                     /translation="MLKVSCDDGSTNVKLAWLEDGEVRTSLSGNSFKEGWNPGLFNAG
                     KVYNYVVDEKKYTYDLGSTAVIGTTHVSYQYSTTNLLAIHHALLTSGLQPQDVELTVT
                     LPVTEFFDNDNQPNEERIERKKANVLREISLNKGETFKIKKVNVMPESLPAAFELLKK
                     DKVNKLERSLIIDLGGTTLDCGLILGAFEGISEIRGYSEIGTSRITHTVMNALTKAST
                     PCNYFIADELIKNRHDNEYLQTLINDVAEIKNISHVIDREVKSLAESIRQEISTFSGM
                     NRIYLTGGGAELIYPHIKQYFPNLKVNKVDEPQFALVKAMVHA"
     gene            65140..>65463
                     /locus_tag="SDY_RS23490"
                     /old_locus_tag="SDY_P076"
                     /pseudo
     CDS             65140..>65463
                     /locus_tag="SDY_RS23490"
                     /old_locus_tag="SDY_P076"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015683198.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1281 domain-containing protein"
     gene            complement(65508..>66269)
                     /locus_tag="SDY_RS23495"
                     /old_locus_tag="SDY_P077"
                     /pseudo
     CDS             complement(65508..>66269)
                     /locus_tag="SDY_RS23495"
                     /old_locus_tag="SDY_P077"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611347.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-like element IS600 family transposase"
     gene            complement(66288..66985)
                     /locus_tag="SDY_RS23500"
                     /pseudo
     CDS             complement(66288..66985)
                     /locus_tag="SDY_RS23500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612230.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            complement(<67041..67441)
                     /locus_tag="SDY_RS23505"
                     /old_locus_tag="SDY_P079"
                     /pseudo
     CDS             complement(<67041..67441)
                     /locus_tag="SDY_RS23505"
                     /old_locus_tag="SDY_P079"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611998.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(<67506..67646)
                     /locus_tag="SDY_RS24525"
                     /pseudo
     CDS             complement(<67506..67646)
                     /locus_tag="SDY_RS24525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611435.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            complement(<67701..68234)
                     /locus_tag="SDY_RS23510"
                     /pseudo
     CDS             complement(<67701..68234)
                     /locus_tag="SDY_RS23510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611134.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(68349..68987)
                     /locus_tag="SDY_RS23515"
                     /old_locus_tag="SDY_P082"
     CDS             complement(68349..68987)
                     /locus_tag="SDY_RS23515"
                     /old_locus_tag="SDY_P082"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000607008.1"
                     /translation="MINGVSLQGTAGYEAHTEEGNVNVKKLLESLNSKSLGDMDKDSE
                     LAATLQKMINPSGGDGNCSGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQI
                     DSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLD
                     VQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC"
     gene            complement(<69146..69615)
                     /locus_tag="SDY_RS23520"
                     /pseudo
     CDS             complement(<69146..69615)
                     /locus_tag="SDY_RS23520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477181.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            69951..>70136
                     /locus_tag="SDY_RS23525"
                     /old_locus_tag="SDY_P084"
                     /pseudo
     CDS             69951..>70136
                     /locus_tag="SDY_RS23525"
                     /old_locus_tag="SDY_P084"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002216098.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
     gene            complement(70236..>70445)
                     /locus_tag="SDY_RS23530"
                     /old_locus_tag="SDY_P085"
                     /pseudo
     CDS             complement(70236..>70445)
                     /locus_tag="SDY_RS23530"
                     /old_locus_tag="SDY_P085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015683482.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding protein"
     gene            71197..71481
                     /locus_tag="SDY_RS23540"
                     /old_locus_tag="SDY_P087"
     CDS             71197..71481
                     /locus_tag="SDY_RS23540"
                     /old_locus_tag="SDY_P087"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribbon-helix-helix protein, CopG family"
                     /protein_id="WP_001178088.1"
                     /translation="MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQA
                     LSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAWADSLSTDHPLPVPR"
     gene            71481..71756
                     /locus_tag="SDY_RS23545"
                     /old_locus_tag="SDY_P088"
     CDS             71481..71756
                     /locus_tag="SDY_RS23545"
                     /old_locus_tag="SDY_P088"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system RelE/ParE family
                     toxin"
                     /protein_id="WP_000421263.1"
                     /translation="MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLT
                     HPRMGEQLFQFEPREVRRIFTGEYEIRYELTGQTIYVLRLWYTRENR"
     gene            complement(71888..72025)
                     /locus_tag="SDY_RS24530"
     CDS             complement(71888..72025)
                     /locus_tag="SDY_RS24530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000766699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000766699.1"
                     /translation="MKLIHGAYEKAAPIIKIGEFAMSGNNVSDGLFASPERDIAASHE
                     R"
     gene            complement(72117..72482)
                     /locus_tag="SDY_RS23555"
                     /old_locus_tag="SDY_P090"
     CDS             complement(72117..72482)
                     /locus_tag="SDY_RS23555"
                     /old_locus_tag="SDY_P090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001630992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning/stability family protein"
                     /protein_id="WP_000361391.1"
                     /translation="MDKRRTIAFKPNPDVNQTDKIVCNTLDSIPQGERSRLNRAALTA
                     DLALYRQDPRPPFLLCELLTKETTFSDIVNILRSLFPKEMVDFNSSTITQSSSQKEQK
                     SDEETQKNVMKLINQFNYY"
     gene            complement(72485..73011)
                     /locus_tag="SDY_RS23560"
                     /old_locus_tag="SDY_P092"
                     /pseudo
     CDS             complement(72485..73011)
                     /locus_tag="SDY_RS23560"
                     /old_locus_tag="SDY_P092"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001115185.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
     gene            <73061..74151
                     /locus_tag="SDY_RS23565"
                     /pseudo
     CDS             <73061..74151
                     /locus_tag="SDY_RS23565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001546148.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing N-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family transposase"
     gene            complement(74527..75220)
                     /locus_tag="SDY_RS23570"
                     /pseudo
     CDS             complement(74527..75220)
                     /locus_tag="SDY_RS23570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477181.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            75460..75678
                     /gene="ccdA"
                     /locus_tag="SDY_RS23575"
                     /old_locus_tag="SDY_P096"
     CDS             75460..75678
                     /gene="ccdA"
                     /locus_tag="SDY_RS23575"
                     /old_locus_tag="SDY_P096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system antitoxin CcdA"
                     /protein_id="WP_000813626.1"
                     /translation="MKQRITVTIDSDSYQLLKSANVNISGLVNTAMQKEARRLRAERW
                     QAENQQGMAEIARFIEMNGSFADENRDW"
     gene            75680..75985
                     /gene="ccdB"
                     /locus_tag="SDY_RS23580"
                     /old_locus_tag="SDY_P097"
     CDS             75680..75985
                     /gene="ccdB"
                     /locus_tag="SDY_RS23580"
                     /old_locus_tag="SDY_P097"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858358.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system toxin CcdB"
                     /protein_id="WP_001159860.1"
                     /translation="MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSD
                     KVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEVADLSHRENDIKNAINLMFWGI"
     gene            <76021..76116
                     /locus_tag="SDY_RS23585"
                     /pseudo
     CDS             <76021..76116
                     /locus_tag="SDY_RS23585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000381338.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase domain-containing protein"
     gene            76244..76938
                     /locus_tag="SDY_RS23590"
     CDS             join(76244..76490,76490..76938)
                     /locus_tag="SDY_RS23590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477181.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
                     /protein_id="WP_164925049.1"
                     /translation="MASVNIHCPRCQSAQVYRHGQNPKGHDRFRCRDCHRVFQLTYTY
                     EARKPGIKELITEMAFNGAGVRDTARTLKIGINTVIRTFKKLTPKRITSSPVAHADVA
                     LICELDEQWSFVGSKARQHWLWYAYNTKTGGVLAYTFGPRTDETCRELLALLTPFNIG
                     MITSDDWGSYGREVPKDKHLTGKIFTQRIERNNLTLRTRIKRLARKTICFLRSVEIHE
                     KVIGTFIEKHMFY"
     gene            77152..78789
                     /gene="ipaH9.8"
                     /locus_tag="SDY_RS23595"
                     /old_locus_tag="SDY_P099"
     CDS             77152..78789
                     /gene="ipaH9.8"
                     /locus_tag="SDY_RS23595"
                     /old_locus_tag="SDY_P099"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858359.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T3SS effector E3 ubiquitin-protein ligase
                     IpaH9.8"
                     /protein_id="WP_000936809.1"
                     /translation="MLPINNNFSLPQNSFYNTISGTYADYFSAWDKWEKQALPGEERD
                     EAVSRLKECLINNSDELRLDRLNLSSLPDNLPAQITLLNVSYNQLTNLPELPVTLKKL
                     YSASNKLSELPVLPPALESLQVQHNELENLPALPDSLLTMNISYNEIVSLPSLPQALK
                     NLRATRNFLTELPAFSEGNNPVVREYFFDRNQISHIPESILNLRNECSIHISDNPLSS
                     HALQALQRLTSSPDYHGPRIYFSMSDGQQNTLHRPLADAVTAWFPENKQSDVSQTWHA
                     FEHEEHANTFSAFLDRLSDTVSARNTSGFREQVAAWLEKLSASAELRQQSFAVAADAT
                     ESCEDRVALTWNNLRKTLLVHQASEGLFDNDTGALLSLGREMFRLEILEDIARDKVRT
                     LHFVDEIEVYLAFQTMLAEKLQLSTAVKEMRFYGVSGVTANDLRTAEAMVRSREENEF
                     TDWFSLWGPWHAVLKRTEADRWALAEEQKYEMLENEYPQRVADRLKASGLSGDADAER
                     EAGAQVMRETEQQIYRQLTDEVLALRLSENGSQLHHS"
     gene            78997..79266
                     /locus_tag="SDY_RS23600"
                     /old_locus_tag="SDY_P100"
     CDS             78997..79266
                     /locus_tag="SDY_RS23600"
                     /old_locus_tag="SDY_P100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000079945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000079957.1"
                     /translation="MAQVNMSVRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQ
                     HNSWFRDQVAAGRQQLECGDVLPHDMVESSAAAWRDEMSRKIAGK"
     gene            79518..80108
                     /gene="ospG"
                     /locus_tag="SDY_RS23605"
                     /old_locus_tag="SDY_P101"
     CDS             79518..80108
                     /gene="ospG"
                     /locus_tag="SDY_RS23605"
                     /old_locus_tag="SDY_P101"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system effector protein
                     kinase OspG"
                     /protein_id="WP_000705601.1"
                     /translation="MKITSTIIQTPFPFENNNSHAGIVTEPILGKLIGQGSTAEIFED
                     VNDSSALYKKYDLIGNQYNEILEMAWQESELFNAFYGDEASVVIQYGGDVYLRMLRVP
                     GTPLSDIDTADIPDNIESLYLQLICKLNELSIIHYDLNTGNMLYDKESESLFPIDFRN
                     IYAEYYAATKKDKEIIDRRLQMRTNDFYSLLNRKYL"
     gene            80447..>80731
                     /locus_tag="SDY_RS24295"
                     /old_locus_tag="SDY_P102"
                     /pseudo
     CDS             80447..>80731
                     /locus_tag="SDY_RS24295"
                     /old_locus_tag="SDY_P102"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001355812.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family insertion sequence element accessory
                     protein TnpB"
     gene            80794..82140
                     /locus_tag="SDY_RS23610"
                     /old_locus_tag="SDY_P103"
     CDS             80794..82140
                     /locus_tag="SDY_RS23610"
                     /old_locus_tag="SDY_P103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_706148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS4-like element IS4 family transposase"
                     /protein_id="WP_011379024.1"
                     /translation="MFPDSFMHIGQALDLVSRYDSLRNPLTSLGDYLAPELISRCLAE
                     SGTVTLRKRRLPLEMMVWCIVGMVLERKEPLHQIVNRLDIMLPGNRPFVAPSAVIQAR
                     QRLGSEAVRRVFTKTAQLWHNATPHPHWCGLTLLAIDGVFWRTPDTPENDAAFPRQTH
                     AGNPALYPQVKMVCQMELTSHLLTAAAFGTMKNSENELAEQLIEQTGDNTLTLMDKGY
                     YSLGLLNAWSLAGEHRHWMIPLRKGAQYEEIRKLGKGDHLVKLKTSPQARKKWPGLGN
                     EVTARLLTVTRKGKVCHLLTSMTDAMRFPGGEMADLYSHRWEIELGYREIKQTMQLSR
                     LTLRSKKPELVEQELWGVLLAYNLVRYQMIKMAEHLKGYWPNQLSFSESCGMVMRMLM
                     TLQGASPGRIPELMRDLASMGQLVKLPTRRERAFPRVVKERPWKYPTAPKKSQSVA"
     gene            complement(<82154..>82345)
                     /locus_tag="SDY_RS24535"
                     /old_locus_tag="SDY_P104"
                     /pseudo
     CDS             complement(<82154..>82345)
                     /locus_tag="SDY_RS24535"
                     /old_locus_tag="SDY_P104"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001743492.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus and C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family insertion sequence element accessory
                     protein TnpB"
     gene            <82343..>82667
                     /locus_tag="SDY_RS23615"
                     /pseudo
     CDS             <82343..>82667
                     /locus_tag="SDY_RS23615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612087.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus and C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            complement(82697..85609)
                     /locus_tag="SDY_RS23620"
                     /old_locus_tag="SDY_P106"
     CDS             complement(82697..85609)
                     /locus_tag="SDY_RS23620"
                     /old_locus_tag="SDY_P106"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164925050.1"
                     /translation="MFSKAFLRKISMFFARRKPAAMKICLYHTLNPDTIPGYKKFAQA
                     IATDNFVQADVRKIDTNLYRARLSIRDRLLFSLYRYHGETICLVLEYIRNHAYNTSRF
                     LRRNVVIDEGRLQQQPVPDPVDIATEALTYINPSHGRFHRLDKMLSFDDDQQALYEHP
                     LPLVIVGSAGSGKTALVLEKMKQAAGDILYLSLSSFLVEKARTLYDASGEGSEVQNID
                     FLSLTEFLETLRIPEGREVTFSAFSDWLPRNRAIAALGAAHTLYEEFRGVIGAVASGN
                     GPLSREAYLSLGIRQSLYGMEDRPTVYVLFERYIAWLKQSHQYDSNLLSHQYLSLATP
                     RYDVIFVDEVQDMTPVQLQLVLKTLRHPGQFLLCGDANQIVHPSFFSWSSLKSLFFRQ
                     QQGNDTTVNILQANYRNGHHVTALANRLLRLKQVRFSAIDRESHHFVRSCGQAEGTIR
                     LLDDREETKQELNAKTSLSNRVAVIVMHPEQKAQARCWFSTPLVFSVQEVKGLEYETV
                     ILYNIVSAARQAFDDICEGLTPADLEGEARYSRPRDKQDRSAEIYKFFTNALYVALTR
                     ATHNVYLVEQQVEHPLWSLLALTHQEEPLNLQEEISSRDEWQKTAHLLEKQGKQEQAD
                     TIRSRILQTSEMPWQIITAEDARQWKQHILAGTADKTIQLQALEYSLIYSLFPLYNAL
                     YREDFKPTRQPRTKTLQLLELKYFRPYSMNNPVAVLRDIERYGVDHRSPFNLTPLMSA
                     ARAGNIALVQLLLERGADPLLTGNDGLAAYHQVLSAAVSTPRYAQQKSAQLYTLLKPE
                     SLSLQVEGRLIKLDNRLMAMFLVILMQALFHTHLGSALFFSEAFSAARLAECVVHLPE
                     ALLPERRKRRSYISSQLSQHEVNSKNPYGKKLFLRLNHGQYILNPGLKIRQGDVWRAV
                     YELQSPEDLGHDLQTYLQDMSPELVDMLGGKKGFYERSEKSVGYWVGGIRRAAQKA"
     gene            85612..85728
                     /locus_tag="SDY_RS23625"
     CDS             85612..85728
                     /locus_tag="SDY_RS23625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004996477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004996477.1"
                     /translation="MPGIPPEIRWNNQKNALQLWNKEGGVVRREGDPLEMAQ"
     gene            86092..86934
                     /locus_tag="SDY_RS23630"
                     /old_locus_tag="SDY_P107"
     CDS             86092..86934
                     /locus_tag="SDY_RS23630"
                     /old_locus_tag="SDY_P107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase family protein"
                     /protein_id="WP_000931198.1"
                     /translation="MLNEGGILFKANHVPVLMYHHVSHCPGLVTLSPVTFRKQMKWLA
                     ENNWKTLSSDELEFFYRGGKLPRKSVMLTFDDGYLDNWFQVYPLLKEFNLKAHIFLIT
                     GFIGNGPVRHSPGKEYSHRDCEHQIATGNADNVMLRWSEVNEMLQSGLVEFHVHTHTH
                     TRWDKKFSSREEQCKHLRQDLLSGREYLKEMTGKCSKHLCWPEGYYNKDYIQVAEELG
                     FYYLYTTERRMNAPAKGTTRIGRISTKERESCAWLKRRLFYYTTPFFSSLLAFHKGPR
                     LPDD"
     gene            86937..88025
                     /gene="capU"
                     /locus_tag="SDY_RS23635"
                     /old_locus_tag="SDY_P108"
     CDS             86937..88025
                     /gene="capU"
                     /locus_tag="SDY_RS23635"
                     /old_locus_tag="SDY_P108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative hexosyltransferase CapU"
                     /protein_id="WP_005015483.1"
                     /translation="MNILFTESSPNIGGQELQAVAQMKALKKMGHSVLLVCRENSKIA
                     FEASKLGIDITFALFRNSLHIPTAWRLLGIVHGFQPNAIVCHSGHDSNIVGLVRLFTW
                     KHPFRIIRQKTYLTRKTKVFSINHFCDEVIVPGTSMKTHLEQEGCRTRVTVVPPGFDF
                     QKLYVDSRNSLPPNVLSWLASRRGCPVIAQVGMLRPEKGHEFMLNLLFHLKMNGRQFC
                     WLIVGSGTPELREHLQYQIDSMGMHDDVFIADNVFPAAPVYRVASLVVLPSENESFGM
                     VLAEASAFSVPVLASQIGGIPDVIQNNQTGTLLPAGNKHAWMCALNDFFNDPGRFYQM
                     ARQAKQDIEERFDINKTALKILTLAKHK"
     gene            88030..88980
                     /gene="virK"
                     /locus_tag="SDY_RS23640"
                     /old_locus_tag="SDY_P109"
     CDS             88030..88980
                     /gene="virK"
                     /locus_tag="SDY_RS23640"
                     /old_locus_tag="SDY_P109"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virulence factor VirK"
                     /protein_id="WP_004970430.1"
                     /translation="MFSVSNLSFIGFLKRIVFSSDSLPGKWEHRKFRFMYILRCAINP
                     VASIRYYYELRSLQCIEDILAIQPTLPARIHRPYLHKGGRAWSRGQYILEHYRFVQNL
                     PEKYSEFLFPQKSVSLVQFIGKDGEDFDIQCSPSGFDREGELMLSLFFNKIVIARLTF
                     SVILTQNGHTAFIGGLQGAPKNTGPDVIRCATRACYGLFPKRIIFEAFCALMKACNVS
                     ECLAVSEHSHVFRQLRYWYQKRKTFVAVYSDFWESVAGKTCGDWYKLPTQVVRKPLSN
                     IASKKRSEYRKRYALLDYIHETAIRSLDAYPVNSEHQDLN"
     gene            89045..89989
                     /gene="lpxM"
                     /locus_tag="SDY_RS23645"
                     /old_locus_tag="SDY_P110"
                     /gene_synonym="msbB"
     CDS             89045..89989
                     /gene="lpxM"
                     /locus_tag="SDY_RS23645"
                     /old_locus_tag="SDY_P110"
                     /gene_synonym="msbB"
                     /EC_number="2.3.1.243"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858371.1"
                     /note="LpxM is lauroyl-Kdo(2)-lipid IV(A)
                     myristoyltransferase, an enzyme characterized in
                     Escherichia coli and involved in biosynthesis of the form
                     of lipid A found in that species and some closely related
                     species; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase"
                     /protein_id="WP_004996485.1"
                     /translation="MKKYKSEFIPEFKKNYLSPVYWFTWFVLGMIAGISMFPPSFRDP
                     VLAKIGRWVGRLSRKARRRATINLSLCFPEKSDTEREIIVDNMFATALQSIVMMAELA
                     IRGPEKFQKRVFWKGLEILEEIRHNNRNVIFLVPHGWSVDIPAMLLAAQGEKMAAMFH
                     QQRNPVIDYVWNSVRRKFGGRLHSREDGIKPFIQSVRQGYWGYYLPDQDHGPEYSEFA
                     DFFATYKATLPIIGRLMNISQAMIIPLFPVYDEKKHFLTIEVRPPMDACIASADNKMI
                     ARQMNKTVEILVGSHPEQYIWVLKLLKTRKSNEADPYP"
     gene            90187..90831
                     /locus_tag="SDY_RS23650"
                     /old_locus_tag="SDY_P111"
     CDS             90187..90831
                     /locus_tag="SDY_RS23650"
                     /old_locus_tag="SDY_P111"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001355812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_134801823.1"
                     /translation="MLYAARKRGLEIGIFCTIHTLRLHFEEHLPLVVAGRRLGVPKST
                     ACSMFVRFRKAGLSWPLPAGMSERELDARLYGSASTVPVVLTESTVMPEVPGGKKRPR
                     RPNFPYEFKIALVEQSLQPGACVAQIARENGINDNLLFNWRHQYRKGGLLPSGKNMPA
                     LLPVTLTPEPDNHGFDIIYTLSTHHQRFTFVRLFDPYLIGSRSTFSHLAHHHIS"
     gene            complement(<90976..91398)
                     /locus_tag="SDY_RS23655"
                     /old_locus_tag="SDY_P112"
                     /pseudo
     CDS             complement(<90976..91398)
                     /locus_tag="SDY_RS23655"
                     /old_locus_tag="SDY_P112"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000154977.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="group II intron reverse transcriptase/maturase"
     gene            <91571..92329
                     /locus_tag="SDY_RS23660"
                     /old_locus_tag="SDY_P114"
                     /pseudo
     CDS             <91571..92329
                     /locus_tag="SDY_RS23660"
                     /old_locus_tag="SDY_P114"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_414557.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS4 family transposase"
     gene            complement(92370..93526)
                     /locus_tag="SDY_RS23665"
                     /old_locus_tag="SDY_P115"
     CDS             complement(join(92370..93277,93277..93526))
                     /locus_tag="SDY_RS23665"
                     /old_locus_tag="SDY_P115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611998.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="WP_134802193.1"
                     /translation="MSRKTQRYSKEFKAEAVRTVLENQLSISEGASRLSLPEGTLGQW
                     VTAARKGLGTPGSRTVAELESEILQLRKALNEARLERDIFKKNNSVFCTGVAEKYALI
                     EQWRQQFPIEAMCQVFGVSRSGYYNWVQHEPSDRKQSDERLKLEIKVAHIRTRETYGT
                     RRLQTELAENGIIVGRDRLARLRKELRQRCKQKRKFRATTNSNHNLPVAPNLLNQTFA
                     PTAPNQVWVADLTYVATQEGWLYLAGIKDVYTCEIVGYAMGERMTKELTGKALFMALR
                     SQRPPAGLIHHSDRGSQYCAYDYRVIQEQFGLKTSMSRKGNCYDNAPMESFWGTLKNE
                     SLSHYRFNNRDEAISVIREYIEIFYNRQRRHSRLGNISSAAFREKYHQMAA"
     gene            <93592..95374
                     /gene="traD"
                     /locus_tag="SDY_RS23675"
                     /old_locus_tag="SDY_P117"
                     /pseudo
     CDS             <93592..95374
                     /gene="traD"
                     /locus_tag="SDY_RS23675"
                     /old_locus_tag="SDY_P117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001589353.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system coupling
                     protein TraD"
     gene            complement(95383..95781)
                     /gene="vapC"
                     /locus_tag="SDY_RS23680"
     CDS             complement(95383..95781)
                     /gene="vapC"
                     /locus_tag="SDY_RS23680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(fMet)-specific endonuclease VapC"
                     /protein_id="WP_000911312.1"
                     /translation="MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELI
                     YGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAAIHTGQIRAELARQGRPVGPFDQMIA
                     GHARSRGLIIVTNNTREFERVGGLRIEDWS"
     gene            complement(95781..96008)
                     /gene="vapB"
                     /locus_tag="SDY_RS23685"
                     /old_locus_tag="SDY_P120"
     CDS             complement(95781..96008)
                     /gene="vapB"
                     /locus_tag="SDY_RS23685"
                     /old_locus_tag="SDY_P120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin-antitoxin system antitoxin VapB"
                     /protein_id="WP_000450529.1"
                     /translation="METTVFLSNRSQAVRLPKAVALPENVKRVEVIAVGRTRIITPAG
                     ETWDEWFDGHSVSADFMDNREQPDMQERESF"
     gene            96090..96509
                     /locus_tag="SDY_RS23690"
                     /old_locus_tag="SDY_P121"
     CDS             96090..96509
                     /locus_tag="SDY_RS23690"
                     /old_locus_tag="SDY_P121"
                     /inference="COORDINATES: protein motif:HMM:NF020332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative relaxase"
                     /protein_id="WP_011379018.1"
                     /translation="MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGQGAEQLGLQ
                     GSVDKDVFTRLLEGRLPDGADLSRMQDGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRL
                     IDAHNQAVDFAVRHHPCGGTGLHTGDDGRTVRNGADR"
     gene            96472..101351
                     /gene="traI"
                     /locus_tag="SDY_RS23695"
                     /old_locus_tag="SDY_P122"
                     /pseudo
     CDS             96472..101351
                     /gene="traI"
                     /locus_tag="SDY_RS23695"
                     /old_locus_tag="SDY_P122"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011379082.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer relaxase/helicase TraI"
     gene            101371..102117
                     /gene="traX"
                     /locus_tag="SDY_RS23700"
                     /old_locus_tag="SDY_P124"
     CDS             101371..102117
                     /gene="traX"
                     /locus_tag="SDY_RS23700"
                     /old_locus_tag="SDY_P124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858383.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus acetylase TraX"
                     /protein_id="WP_000205723.1"
                     /translation="MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLM
                     VLDHINLIFQLKQEWMFLAGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQF
                     AYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAG
                     LLMLAVSNRLYRAEDRAERLALVACLLAVIPALNLATSDAAAVAGLVMTVLTVGLVLC
                     AGKSLPRFWPGDFFPTFYACHLAVLGVLVL"
     gene            102172..102732
                     /locus_tag="SDY_RS23705"
                     /old_locus_tag="SDY_P125"
     CDS             102172..102732
                     /locus_tag="SDY_RS23705"
                     /old_locus_tag="SDY_P125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fertility inhibition protein FinO"
                     /protein_id="WP_000139365.1"
                     /translation="MTEQKRPVLTLKRKTEGTAPVRSRKTIINVTTPPKWKVKKQKLA
                     EKAAREAELAAKKAQARQALSIYLNLPTLDEAVNILKPWWPGLFDGDTPRLLACGIRD
                     VLLEDVAQRDIPLSHKKLRRALKAITRSESYLCAMKAGACRYDTEGYVTEHISQEEEA
                     YAGARLAKIRRQNRIKAELQAVLDEK"
     gene            102863..103075
                     /locus_tag="SDY_RS23710"
                     /old_locus_tag="SDY_P126"
     CDS             102863..103075
                     /locus_tag="SDY_RS23710"
                     /old_locus_tag="SDY_P126"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ANR family transcriptional regulator"
                     /protein_id="WP_004971339.1"
                     /translation="MNGFRNSSRNGQVWRYQRAGGRAVILEVSGRWMEAAEAWRRAAC
                     VAPRTDWQQFARKRAEHCHRRCRGRV"
     gene            103319..>103480
                     /locus_tag="SDY_RS24540"
                     /pseudo
     CDS             103319..>103480
                     /locus_tag="SDY_RS24540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052672.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
     gene            complement(103496..104192)
                     /locus_tag="SDY_RS23715"
                     /pseudo
     CDS             complement(103496..104192)
                     /locus_tag="SDY_RS23715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612230.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            <104239..104557
                     /locus_tag="SDY_RS23720"
                     /old_locus_tag="SDY_P130"
                     /pseudo
     CDS             <104239..104557
                     /locus_tag="SDY_RS23720"
                     /old_locus_tag="SDY_P130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052672.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="thermonuclease family protein"
     gene            104603..104811
                     /gene="hha"
                     /locus_tag="SDY_RS23725"
                     /old_locus_tag="SDY_P131"
                     /pseudo
     CDS             104603..104811
                     /gene="hha"
                     /locus_tag="SDY_RS23725"
                     /old_locus_tag="SDY_P131"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_958726.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin expression modulator Hha"
     gene            complement(104960..105654)
                     /locus_tag="SDY_RS23730"
     CDS             complement(join(104960..105408,105408..105654))
                     /locus_tag="SDY_RS23730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477181.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
                     /protein_id="WP_134801812.1"
                     /translation="MASVNIHCPRCQSAQVYRHGQNPKGHDRFRCRDCHRVFQLTYTY
                     EARKPGIKELITEMAFNGAGVRDTARTLKIGINTVIRTFKKLTPKQITSSPVAHADVA
                     LICELDEQWSFVGSKARQHWLWYAYNTKTGGGLAYTFGPRTDETCRELLALLTPFNIR
                     MITSDDWGSYGREVPKDKHLTGKIFTQRIERNNLTLRTRIKRLARKTICFSRSVEIHE
                     KVIGTFIEKHMFY"
     gene            <105702..106214
                     /locus_tag="SDY_RS23735"
                     /old_locus_tag="SDY_P135"
                     /pseudo
     CDS             <105702..106214
                     /locus_tag="SDY_RS23735"
                     /old_locus_tag="SDY_P135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858390.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2726 domain-containing protein"
     gene            106454..106714
                     /gene="repA"
                     /locus_tag="SDY_RS23740"
                     /old_locus_tag="SDY_P136"
     CDS             106454..106714
                     /gene="repA"
                     /locus_tag="SDY_RS23740"
                     /old_locus_tag="SDY_P136"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication regulatory protein RepA"
                     /protein_id="WP_000083819.1"
                     /translation="MSQTENAVTSSLSQKRFVRRGKPMTDSEKQMAAVARKRLTHKEI
                     KVFVKNPLKDLMVEYCEREGITQAQFVEKIIKDELQRLDILK"
     gene            106938..107012
                     /gene="tap"
                     /locus_tag="SDY_RS23745"
     CDS             106938..107012
                     /gene="tap"
                     /locus_tag="SDY_RS23745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001370046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RepA leader peptide Tap"
                     /protein_id="WP_001365705.1"
                     /translation="MPGKVQDFFLCSLLLRIVSAGWCD"
     gene            107005..107862
                     /gene="repA"
                     /locus_tag="SDY_RS23750"
                     /old_locus_tag="SDY_P137"
     CDS             107005..107862
                     /gene="repA"
                     /locus_tag="SDY_RS23750"
                     /old_locus_tag="SDY_P137"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858393.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="incFII family plasmid replication initiator
                     RepA"
                     /protein_id="WP_000130974.1"
                     /translation="MTDLQQTYYRQVKNPNPVFTPREGARTLPFCGKLMEKAVGFTSR
                     FDFAIHVAHARSLGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECG
                     LATESDAGTLSITRATRALTFLAELGLITYQTEYDPLIGCNIPTDITFTPALFAALDV
                     SEEAVASARRSRVEWENRQRKKQGLDTLGMDELMAKAWRFVRERFRSYQTELKSRGMK
                     RARARRDADRQRQDIVTLVKRQLTREISEGRFTASREAVKREVERRVKERMILSRNRN
                     YSRLATASP"
     gene            complement(108972..110180)
                     /locus_tag="SDY_RS23760"
                     /old_locus_tag="SDY_P139"
     CDS             complement(108972..110180)
                     /locus_tag="SDY_RS23760"
                     /old_locus_tag="SDY_P139"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000198547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS91 family transposase"
                     /protein_id="WP_000198558.1"
                     /translation="MTRSGGDFQPRPLKRLFTTNQCWTSFLDAGGLRDIEVEAVTKML
                     ACGTRILGVKEYNCDKPECPHVRYVTNSCGSRACPSCGKKATDLWIATQLNRLPDCDW
                     VHLVFTLPDTLWPVFESNRWLLNDVCRLAVENLLYAARKRGQEPGIFCAIHTYGRRLN
                     CHPHVHVSVTCGCLNKHGQWKKLSFLKDAMRSRWMWNMRQLLLKAWSEGLAMPESLSH
                     ITTESQWRSLVLKAGGKYWHVYMSKKTAGGRNTARYLGRYLKKPPIAASRLAHYNGGA
                     SLSFRYLDHKTGETATETLTQRELVARLKQHIPEKFFKMVRYFGFLANRVCGEKLPQV
                     YRALGMDKPAPVAKVCYAQMVKQFLSRDPFECVLCGGRMVYRRAIAGLNVEGLKKNAR
                     DISLLRYMPA"
     gene            complement(110161..110433)
                     /locus_tag="SDY_RS23765"
                     /old_locus_tag="SDY_P141"
     CDS             complement(110161..110433)
                     /locus_tag="SDY_RS23765"
                     /old_locus_tag="SDY_P141"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_145811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000019161.1"
                     /translation="MSHNLEHQKVHTRMVKEVLKAVARANNHPYQSVFTDFIAGHPSC
                     TVCFWETFHKMSPDSPYEYVTFCHTCRRFDLYETEAEMKADDPKWW"
     gene            110427..111971
                     /locus_tag="SDY_RS23770"
                     /old_locus_tag="SDY_P140"
     CDS             110427..111971
                     /locus_tag="SDY_RS23770"
                     /old_locus_tag="SDY_P140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="WP_011379009.1"
                     /translation="MTWELILDGYSESSYSATPRFAAARLPWFPENKQSNVSQIWHAF
                     EHEEHANTFSAFLDRLSDTVSARNTSGFREQVAAWLEKLSASAELRQQSFAVAADATE
                     SCEDRVALTWNNLRKTLLVHQASEGLFDNDTGALLSLGREMFRLEILEDIARDKVRTL
                     HFVDEIEVYLAFQTMLAEKLQLSTAVKEMRFYGVSGVTANDLRTAEATVRSREENEFT
                     DWFSLWGPWHAVLKRTEADRWAQAEEQKYEMLENEYSQRVADRLKASGLSGDADAERE
                     AGAQVMRETEQQIYRQLLREGIRVARCTVARLMAVMGLAGVLRGKKVRTTISRKAVAA
                     GDRVNRQFVAERPDQLRVADFTYASTWQGFVYVAFIIDVFAGYIVGWRVSSSMETTFV
                     LDALEQALWARRPSGTVHHSDKGSQYVSLAYTQRLKEAGLLASTGSTGDSYDNAMAES
                     INGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLERLGHTPPAEAEKAYYASIG
                     NDDLAA"
     gene            complement(<112014..112537)
                     /locus_tag="SDY_RS23775"
                     /pseudo
     CDS             complement(<112014..112537)
                     /locus_tag="SDY_RS23775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611998.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(112605..113087)
                     /locus_tag="SDY_RS23780"
                     /old_locus_tag="SDY_P144"
     CDS             complement(112605..113087)
                     /locus_tag="SDY_RS23780"
                     /old_locus_tag="SDY_P144"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_000405248.1"
                     /translation="MEINVTAPALLTDEHILQPFDCGNEVLSNWLRGRAMKNQMLNAS
                     RTFVICLEDTLRVVGYYSLATGSVTHAELGRSLRHNMPNPVPVVLLGRLAVDVCTQGH
                     GFGKWLLSDAIHRVVNLADQVGIKAVMVHAIDDDARAFYERFGFVQSVVAPNTLFYKV
                     "
     gene            complement(113078..113380)
                     /locus_tag="SDY_RS23785"
                     /old_locus_tag="SDY_P145"
     CDS             complement(113078..113380)
                     /locus_tag="SDY_RS23785"
                     /old_locus_tag="SDY_P145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858193.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1778 domain-containing protein"
                     /protein_id="WP_162147618.1"
                     /translation="MEFFMSTAASVRKTPREHQINIRATDEERAVIDYAASLVNKNRT
                     DFIMELAYQEAKNIILDQRLFVLDNERYDSFITQLEAPVQNAEGRERLMAVKPEWK"
     gene            complement(113794..114492)
                     /locus_tag="SDY_RS23790"
                     /old_locus_tag="SDY_P146"
     CDS             complement(113794..114492)
                     /locus_tag="SDY_RS23790"
                     /old_locus_tag="SDY_P146"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_072056208.1"
                     /translation="MSQQAVDQEWSYMDFLEHLLHEEKLARHQRKQAMYTRMAAFPAV
                     KTFEEYDFTFATGAPQKQLQSLRSLSFIERNENIVLLGPSGVGKTHLAIAMGYEAVRA
                     GIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVMAPRLLIIDEIGYLPFSQEEAKLFF
                     QVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTSAMLGRILHHSHVVQIKGESYRLR
                     QKRKAGVIAEANPE"
     gene            complement(<114661..115803)
                     /locus_tag="SDY_RS23795"
                     /old_locus_tag="SDY_P147"
                     /pseudo
     CDS             complement(<114661..115803)
                     /locus_tag="SDY_RS23795"
                     /old_locus_tag="SDY_P147"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000198547.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS91 family transposase"
     gene            complement(115784..116056)
                     /locus_tag="SDY_RS23800"
                     /old_locus_tag="SDY_P148"
     CDS             complement(115784..116056)
                     /locus_tag="SDY_RS23800"
                     /old_locus_tag="SDY_P148"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_145811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000019161.1"
                     /translation="MSHNLEHQKVHTRMVKEVLKAVARANNHPYQSVFTDFIAGHPSC
                     TVCFWETFHKMSPDSPYEYVTFCHTCRRFDLYETEAEMKADDPKWW"
     gene            complement(<116139..116663)
                     /locus_tag="SDY_RS23805"
                     /old_locus_tag="SDY_P149"
                     /pseudo
     CDS             complement(<116139..116663)
                     /locus_tag="SDY_RS23805"
                     /old_locus_tag="SDY_P149"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_709480.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(116800..116973)
                     /locus_tag="SDY_RS23810"
                     /old_locus_tag="SDY_P150"
     CDS             complement(116800..116973)
                     /locus_tag="SDY_RS23810"
                     /old_locus_tag="SDY_P150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013185571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011379008.1"
                     /translation="MDSINVRFSSPPQDSCLLLYDSMEFKLDLIEKSYQLGACVAQLA
                     REYGINDNLLFTW"
     gene            117314..118768
                     /locus_tag="SDY_RS23815"
                     /old_locus_tag="SDY_P151"
     CDS             117314..118768
                     /locus_tag="SDY_RS23815"
                     /old_locus_tag="SDY_P151"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T3SS effector OspC family protein"
                     /protein_id="WP_011379007.1"
                     /translation="MKIPEAVNHINVQNNVDLVDGKTNPNKATKALQKNILRVTNSSS
                     SGISEKHLDHCANTVKNFLRKSIAAQSYSKMFSQGTSFKSLNLSIEAPSGARSSFRSL
                     EHLDKVSRHYISEIIQKVHPLSSDERHLLSIIINSNFNFRHQSNSNLSNNILNIKSFD
                     KIQSENIQTHKNTYSEDIKEISNHDFVFFGVEISNHQEKLPLNKTHHTVDFGANAYII
                     DHDSPYGYMTLTDHFDNAIPPVFYHEHQSFFLDNFKEVVDEVSRYVHGNQGKTDVPIF
                     NTKDMRLGIGLHLIDFIRKSKDQGFREFCYNKNIDPVSLDRIINFVFQLEYHIPRMLS
                     TDNFKKIKLRDISLEDAIKASNYEEINNKVTDKKMAHQALAYSLGNKKADIALYLLSK
                     FNFTKQDVAEMEKMNNNRYCNLYDVEYLLSKDGANYKVLEYFINNGLVDVNKKFQKVN
                     SGDTMLDNAMKSKDSKMIDFLLKNGAILGKRFEI"
     gene            119107..120263
                     /locus_tag="SDY_RS23825"
                     /old_locus_tag="SDY_P153"
     CDS             join(119107..119365,119365..120263)
                     /locus_tag="SDY_RS23825"
                     /old_locus_tag="SDY_P153"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611347.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="WP_171554051.1"
                     /translation="MSRKTQRYSTEFKAEAVKTVPENQLSISEGPSRLSVPEGTLGQW
                     VTAARKGLNTPGSRTVAELESEVMQLRKALNEARLERDILKKGNSVFCPGVAEKYALV
                     EQWRQQFPVEAMCRVPGVSRSGYYDRVQHAPSDRKQSDERLKLEIKVAHIRTRETYGT
                     RRLQTELEDNGIIVGRDRLARLRKELRLHCKQKRKFRATTNSDHNLPVTPNLLNQNFT
                     PTAPNQVWVADITYVATREGWLYLAGVKDVYTCEIVGYAMGERMTKELTGKALFMALR
                     SQRPPAGLIHHTDRGSQYCAYDYRVIQEQSGLKTSMSRKGNCYDNAPMESFWGTLKNE
                     SLSHYRFKSRDEAISVIREYIEIFYNRQRRHSRLGNISPAAFRIKYYQMTA"
     gene            <120304..121107
                     /locus_tag="SDY_RS23830"
                     /pseudo
     CDS             <120304..121107
                     /locus_tag="SDY_RS23830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013512832.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            <121222..>121563
                     /locus_tag="SDY_RS23835"
                     /pseudo
     CDS             <121222..>121563
                     /locus_tag="SDY_RS23835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000952428.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus and C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS21 family transposase"
     gene            121670..122101
                     /locus_tag="SDY_RS23840"
     CDS             121670..122101
                     /locus_tag="SDY_RS23840"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_162147615.1"
                     /translation="MVRAAQNRRLEEAPGKLFELPEVLATAGSHTLNVMQKGGRAARQ
                     ARMFISYSEVSIKNPDNSGQALPLTYVCCREQAEDGACWHLLTSGKAASAADARRIVS
                     HYERRWLTEEYHKAWKSGGTWNRCECRPGITLSAWWLSRRL"
     gene            122077..122343
                     /locus_tag="SDY_RS23845"
     CDS             122077..122343
                     /locus_tag="SDY_RS23845"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_162147616.1"
                     /translation="MVVIKAFIAVRVLGLRQGGVSEETQNDSCEKILTPTEWKLLWVK
                     LEGKPLPVQAPTLKWAWGDGMTANAQVVPVGSSCGMAGQTSGYG"
     gene            complement(122432..123628)
                     /locus_tag="SDY_RS23850"
                     /old_locus_tag="SDY_P158"
     CDS             complement(122432..123628)
                     /locus_tag="SDY_RS23850"
                     /old_locus_tag="SDY_P158"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001297906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
                     /protein_id="WP_011379003.1"
                     /translation="MTESSDYESVQVFIGVDVGKDTHHAVAINRSGKRLFDKALPNDE
                     NKLRSLISDLKQHGQILLVVDQPATIGALPVAVARSEGVLVGYLPGLAMRRIADLHAG
                     EAKTDARDAAIIAEAARTLPHALRTLKLADEQIAELSMLCGFNDDLAAQTTQASNRIR
                     GLLTQIHPALERVLGPRLEHPAVLDLLQRYPSPEKLASLGEKKLAAQLCKLAPRLGKR
                     LAADIAQALAEQTVVVPGTNAAAVVLPRLALQLITLRKQRDEVALEVEQRVLAHPLYP
                     VLTSMPGAGVRTAARLLTEVACRAFASAAHLAAYAGLAPVTRRSGSSIRGEHPSRRGN
                     KALKRALFLSAFAALRDPLSRAYYTRKMSQGKRHNQALIALARRRCDVLFAMMRDGTF
                     YPPQGS"
     gene            complement(123820..124813)
                     /locus_tag="SDY_RS23855"
                     /old_locus_tag="SDY_P159"
                     /pseudo
     CDS             complement(123820..124813)
                     /locus_tag="SDY_RS23855"
                     /old_locus_tag="SDY_P159"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858254.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS21 family transposase"
     gene            126165..126944
                     /gene="ipaJ"
                     /locus_tag="SDY_RS23860"
                     /old_locus_tag="SDY_P160"
     CDS             126165..126944
                     /gene="ipaJ"
                     /locus_tag="SDY_RS23860"
                     /old_locus_tag="SDY_P160"
                     /EC_number="3.4.22.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858255.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system effector cysteine
                     protease IpaJ"
                     /protein_id="WP_024263024.1"
                     /translation="MSEQRKPCKRGCIHTGVMLYGVLLQGAIPREYMISHQTDVRVNE
                     NRVNEQGCFLARKQMYDNSCGAASLLCAAKELGVDKIPQYKGSMSEMTRKSSLDLDNR
                     CERDLYLITSGNYNPRTHKDNIADAGYSMPDKIVMATRLLGLNAYVVEESNIFSQVIS
                     FIYPDARDLLIGMGCNIVHQRDVLSSNQRVLEAVAVSFIGVPVGLHWVLCRPDGSYMD
                     PAVGENYSCFSTMELGARRSNSNFIGYTKIGISIVITNEAL"
     gene            complement(127894..128823)
                     /locus_tag="SDY_RS23865"
                     /old_locus_tag="SDY_P161"
     CDS             complement(127894..128823)
                     /locus_tag="SDY_RS23865"
                     /old_locus_tag="SDY_P161"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParB/RepB/Spo0J family partition protein"
                     /protein_id="WP_000227976.1"
                     /translation="MVDLCNDLLSIKEGQKKEFTLHSGNKVSFIKAKIPHKRIQDLTF
                     VNQKTNVRDQESLTEESLADIIKTIKLQQFFPVIGREIDGRIEILDGTRRRASAIYAG
                     ADLEVLYSKEYISTLDARKLANDIQTAKEHSIRELGIGLNFLKVSGMSYKDIAKKENL
                     SRAKVTRAFQAASVPQEIISLFPIASELNFNDYKILFNYYKGLEKANESLSSTLPILK
                     EEIKDLDTNLPPDIYKKEILNIIKKSKNRKQNPSLKVDSLFISKDKRTYIKRKENKTN
                     RTLIFTLSKINKTVQREIDEAIRDIISRHLSSS"
     gene            complement(129030..129266)
                     /locus_tag="SDY_RS23870"
                     /old_locus_tag="SDY_P162"
     CDS             complement(129030..129266)
                     /locus_tag="SDY_RS23870"
                     /old_locus_tag="SDY_P162"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_000588956.1"
                     /translation="MIKERILSIVAFCYGIAYSKLSEETKFIEDLSADSLSLIEMLDM
                     ISFEFNLRIDESALEHIITIGDLISVVKNSTKSI"
     gene            complement(129270..131171)
                     /gene="ipaA"
                     /locus_tag="SDY_RS23875"
                     /old_locus_tag="SDY_P163"
     CDS             complement(129270..131171)
                     /gene="ipaA"
                     /locus_tag="SDY_RS23875"
                     /old_locus_tag="SDY_P163"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T3SS effector invasin IpaA"
                     /protein_id="WP_011379000.1"
                     /translation="MHNVNNTQATTFLYKATSPSSTEYSELKSKISDIHSSQTSLKTP
                     SSVSEKESFATSFNQKCLDFLFSSSGKEDVLRSIYSNSMNAYAKSEIIEFSNVLYSLV
                     HQNGLNFENEKGLQKIVAQYSELIIKDKLSQDSAFGPWSAKNKKLHQLRQNIEHRLAL
                     LAQQHTSGEALSLGQKLLNTEVSSFIKNNILAELKLSNETVSSLKLDDLVDAQAKLAF
                     DSLRNQRKNTIDSNGFGIGKLSRDLNTVAVFPELLRKVLNNILEDIKDSHPIQDGLPT
                     PPKDMPDGGPTPGANEKTSQPVIHYHINNDNRTYDNRVFDNRVYDNSYHENPENDAQS
                     PTSQTNDLLPRNANSLLNPQRALVQKVTSVLPHSISDTVQTFANNSALEKVFNHTPDN
                     SDGIDSDLLTTSSQERSANNSLSRGHRPLNIQNSSTTTPLRPEGVTNSNDNSSDTTKS
                     SASFSHRVTSQISKFNSNTDSKVLQTDFLSRNGDPYLTRETIFEASKKVTNSLSNLIS
                     LIGTKSGTQERELQEKSKDITKSTTEHRINNKLKITDANTLNYVTETNADTIDKNHAI
                     YEKAKEVSSALSKVLSKIDDTSAELLTEDISNLKNNNDITAENNNIYKAAKDVTTSLS
                     KVLKNINKD"
     gene            complement(131180..132178)
                     /gene="ipaD"
                     /locus_tag="SDY_RS23880"
                     /old_locus_tag="SDY_P164"
     CDS             complement(131180..132178)
                     /gene="ipaD"
                     /locus_tag="SDY_RS23880"
                     /old_locus_tag="SDY_P164"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system needle tip complex
                     protein IpaD"
                     /protein_id="WP_001028028.1"
                     /translation="MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSL
                     TMLNDTLHNIRTTNQALKKDLSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILSKK
                     EYPINKDARELLHSAPEEAELDGYQMISHRELWDKIAKSINNINEQYLKVYEHAVSSY
                     TQMYQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKAELTKLKEKYEDKPLYPANNTV
                     SKEQADKWLTELGGTIGTVSRKNGGYVVNINMSPIDNMLKSLNNLGGNGEVVLDNAKY
                     QAWNAGFSAEDETMKNNLQTLVQKYSNANSIFDNLVKVLSSTISSCTDTDKLFLHF"
     gene            complement(132229..133320)
                     /gene="ipaC"
                     /locus_tag="SDY_RS23885"
                     /old_locus_tag="SDY_P165"
     CDS             complement(132229..133320)
                     /gene="ipaC"
                     /locus_tag="SDY_RS23885"
                     /old_locus_tag="SDY_P165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858260.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T3SS translocon subunit IpaC"
                     /protein_id="WP_000405469.1"
                     /translation="MEIQNTKPTQILYTDISTKQTQSSSETQKSQNYQQIAAHIPLNA
                     GKNPVLTTTLNDDQLVKLSEQVQHDSEIIARLTDKKMKDLSEMSHTITPENTLDISSL
                     SSNAVSLIISVAVLLSALRTAETKLGSQLSLIAFDATKSAAENIVRQGLAALSSSITG
                     AVTQVGITGIGAKKTHSGISEQKGALRKNLATAQSLEKELAGSKLGLNKQIDTNITSP
                     QTNSSTKILGKNKLAPDNISLSTEHKTSLSSPDISLQDKIDTQRRAYELNTLSAQQKQ
                     NIGRATMETSAVAGNISTSGGRYASALEEEEQLISQASSKQAEEASQVSKEASQATNQ
                     LIQKLLNIIDNINQSRSSTASQIAGNIRA"
     gene            complement(133340..135082)
                     /gene="ipaB"
                     /locus_tag="SDY_RS23890"
                     /old_locus_tag="SDY_P166"
     CDS             complement(133340..135082)
                     /gene="ipaB"
                     /locus_tag="SDY_RS23890"
                     /old_locus_tag="SDY_P166"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system translocon subunit
                     IpaB"
                     /protein_id="WP_000552051.1"
                     /translation="MHNVSTTNTGLPLAKILASTELGDNTIQAANDAANKLFSLTIAD
                     LTANNNINTTNAHSTSNILIPELKAPKSLNASSQLTLLIGNLIQILGEKSLTALTNKI
                     TAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQ
                     IQTRLSELAPDSPEKKKLRREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLE
                     KEIDSFSAFSNTASAEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQ
                     SLQESRKTEMERKSDEYAAEVRKAEELNRVMGCVGKILGALLTIVSVVAAAFSGGSSL
                     ALAAVGLALMVTDAIVQAATGNSFMEQALNPIMKAVIEPLIKLLSDAFTKMLEGLGVD
                     SKKAKMIGSILGAIAGALVLVAAVVLVATVGKQAAAKLAENIGKIIGKTLTDLIPKFL
                     KNFSSQLDDLITNAVARLNKFLGAAGDEVISKQIISTHLNQAVLLGESVNSATQAGGS
                     VASAVFQNNASTNLADLTLSKYQVEQLSKYISEAIEKFGQLQEVIADLLASMSNSQAN
                     RTDVAKAILQQTTA"
     gene            complement(135088..135555)
                     /gene="ipgC"
                     /locus_tag="SDY_RS23895"
                     /old_locus_tag="SDY_P167"
     CDS             complement(135088..135555)
                     /gene="ipgC"
                     /locus_tag="SDY_RS23895"
                     /old_locus_tag="SDY_P167"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SycD/LcrH family type III secretion system
                     chaperone IpgC"
                     /protein_id="WP_000055835.1"
                     /translation="MSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAY
                     DFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKN
                     DYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQDIKE"
     gene            complement(135613..136239)
                     /gene="ipgB1"
                     /locus_tag="SDY_RS23900"
                     /old_locus_tag="SDY_P168"
     CDS             complement(135613..136239)
                     /gene="ipgB1"
                     /locus_tag="SDY_RS23900"
                     /old_locus_tag="SDY_P168"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion effector IpgB1"
                     /protein_id="WP_001166524.1"
                     /translation="MQILNKILPQVEFAIPRPSFNSLSHNKLVKKILSVFNLKQRFPH
                     KNFGCPVNINKIRDSVIDKIKDSNSGDQLFCWMSQERTSYVSSMINRSIDEMAIHNGV
                     VLTSDNKKNIFAAIEKKFPDIKLDEKSAQTSISHTALNEIASSGLRAKILKRYSSDMD
                     LFNTQMKDLTNLVSSSVYDKIFNESTKVLQIEISAEVLKAVYRQSNTN"
     gene            complement(136255..136644)
                     /gene="ipgA"
                     /locus_tag="SDY_RS23905"
                     /old_locus_tag="SDY_P169"
     CDS             complement(136255..136644)
                     /gene="ipgA"
                     /locus_tag="SDY_RS23905"
                     /old_locus_tag="SDY_P169"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system chaperone IpgA"
                     /protein_id="WP_010921664.1"
                     /translation="MCRKLYDKLYEITGAKLDFNDKNQAFILLEEQIPVCITDNDEYI
                     FLTGLLNEHELFTENIINPEHILILNYSLSRDYGSSICLLPDTHQCVLTKKHYKKYLS
                     PDELIESLYEFLFCIKLTIANITSEVN"
     gene            complement(136657..138141)
                     /gene="icsB"
                     /locus_tag="SDY_RS23910"
                     /old_locus_tag="SDY_P170"
     CDS             complement(136657..138141)
                     /gene="icsB"
                     /locus_tag="SDY_RS23910"
                     /old_locus_tag="SDY_P170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system effector IcsB"
                     /protein_id="WP_000601046.1"
                     /translation="MILKISNFIDASNTKGPIRVEDTEHGPILVAQKFNLKDLFFRTL
                     STINAKINSQILNEQLKNYRLANQKSLLLFLKTLASEKSAESAFAAYEAVKNSIQHSF
                     TGKDIKLMLNTAERFHGIGTAKNLERHLVFRCWENRGITHLGHTSISIKNNLLQEPTH
                     TYLSWYPGGNVTKDTEINYLFEKRSGYSVDTYKQDKLNMISDQTAERLDAGQEVRNLL
                     NSKQDQNNNKKIFFPRANQKKDPYGYWGVSADKVYIPLSGDNKTKDGKISYNLFGLDE
                     TNMSKFICQKKADAFRQLANYKLISKSENCAGMALNVLKAGNSEIYFPLPDVKLVATP
                     NNVYAYANKVRQRIESLNQSYNEIMKYIESDFDLSRLTQLRRSYLKSFNKINLIHTPK
                     TFKPLSISLYKHPTENVSSEDFDAVINACHSYLVKSAPSNMSRVLNELKTGATDKKEE
                     IIEKSIKTIDYYNSLKSPDLGTKLYIHDLLQVNKLLLNNSHSNI"
     gene            138455..140071
                     /locus_tag="SDY_RS23915"
                     /old_locus_tag="SDY_P171"
     CDS             138455..140071
                     /locus_tag="SDY_RS23915"
                     /old_locus_tag="SDY_P171"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system effector inositol
                     phosphate phosphatase"
                     /protein_id="WP_000548332.1"
                     /translation="MHITNLGLHQVSFQSGDSYKGAEETGNQKSVSVISYQRVKNGER
                     NKGVEALNRLYLQNQTSLTGKGLLFARDRAAVFYEAIKLAGGDTSKIKAMMEQLDTYK
                     LGEVDKRNINELNKVISEEIRAQLGIKNKKELQSEIKQIFTNHLNNKNWEPINKNINY
                     HGKNYGFQLTPASHMKIGNKNIFVKEYNGKGICCASTRESQHIANMWLSKVVDDEGKE
                     IFSGIRHGVISAYGLKKNSSERAVAARNKAEELASAALYSRRELLSQALSGKTVDLKI
                     VSTSLLTPTSLTGGEESMLKDQVKALKGLNSKRGEPTKLLIRNSDGLLQEVNVNLKVV
                     TFNFGVNELALKMGLGWRNVDKLNGESICSLLGDNFLKNGVIGGWAAEAIEKNPSCKN
                     DVIYLANQIKEILNKKLQKNDNGEPYKLSQRMALLAYTIGAVPCWNCKSGKDRTGMQD
                     AEIKREIIRKHETGQFSQLNSKLSSEEKRLFSTILMNSGNMEIQEMNTGVPGNKVMKK
                     LPLSSLELSYAERIGDPKIWNMVKGYSSFV"
     gene            140081..140443
                     /gene="ipgE"
                     /locus_tag="SDY_RS23920"
                     /old_locus_tag="SDY_P172"
     CDS             140081..140443
                     /gene="ipgE"
                     /locus_tag="SDY_RS23920"
                     /old_locus_tag="SDY_P172"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system chaperone IpgE"
                     /protein_id="WP_000389733.1"
                     /translation="MEDLADVICRALGIPSIDTDDQAIMLDDDVLIYIEKEGDSINLL
                     CPFCALPENINDLIYALSLNYSEKICLATDDEGGSLIARLDLTGINEFEDIYVNTEYY
                     ISRVRWLKDEFARRMKGY"
     gene            140443..140901
                     /gene="ipgF"
                     /locus_tag="SDY_RS23925"
                     /old_locus_tag="SDY_P173"
     CDS             140443..140901
                     /gene="ipgF"
                     /locus_tag="SDY_RS23925"
                     /old_locus_tag="SDY_P173"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system lytic transglycosylase
                     IpgF"
                     /protein_id="WP_000086107.1"
                     /translation="MSRFVFILLCFIPHLGRADCWDKAGERYNIPSSLLKAIAEKESG
                     FNKSAVNVNNNGSKDYGIMQINDFHSKRLREMGYTEEMLISHPCLSVHYAAKLLNEFM
                     LMYGRGWEAVGAYNAGTSPKKKKERLKYAEDIYKRYLRIAAESKQNNRRI"
     gene            140910..142025
                     /gene="mxiG"
                     /locus_tag="SDY_RS23930"
                     /old_locus_tag="SDY_P174"
     CDS             140910..142025
                     /gene="mxiG"
                     /locus_tag="SDY_RS23930"
                     /old_locus_tag="SDY_P174"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system protein MxiG"
                     /protein_id="WP_001287355.1"
                     /translation="MSEAKNSNLAPFRLLVKLTNGVGDEFPLYYGNNLIVLGRTIETL
                     EFGNDNFPENIIPVTDSKSDGIIYLTISKDNICQFSDEKGEQIDINSQFNSFEYDGIS
                     FHLKNMREDKSRGHILNGMYKNPSVFFFFAVIVVLIIIFSLSLKKDEVKEIAEIIDDN
                     RYGIVNTGQCNYILAETQNDAVWASVALNKTGFTKCRYILVSNKEINRIQQYINQRFP
                     YINLYVLNLVSDKAELLVFLSKERNSSKDTELDKLKNALIVEFPYIKNIKFNYLSDHN
                     ARGDAKGIFTKVNVQYKEICENNKVTYSVREELTDEKLELINRLISEHKNIYGDQYIE
                     FSVLLIDDDFKGKSYLNSKDSYVMLNDKHWFFLDKNK"
     gene            142033..142284
                     /locus_tag="SDY_RS23935"
                     /old_locus_tag="SDY_P175"
     CDS             142033..142284
                     /locus_tag="SDY_RS23935"
                     /old_locus_tag="SDY_P175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system needle complex
                     protein"
                     /protein_id="WP_011378999.1"
                     /translation="MSVTVPNKDWTLSSLSETFDDGTQTLQGELTLALEALATNPSNP
                     QLLAEYQSKLSEYTLYRNAQSNTVKVIKDVDAAIIQNYR"
     gene            142297..142590
                     /gene="mxiI"
                     /locus_tag="SDY_RS23940"
                     /old_locus_tag="SDY_P176"
     CDS             142297..142590
                     /gene="mxiI"
                     /locus_tag="SDY_RS23940"
                     /old_locus_tag="SDY_P176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system inner rod protein
                     MxiI"
                     /protein_id="WP_001106824.1"
                     /translation="MNYIYPVNQVDIIKASDFQSQEISSLEEVVSAKYSDIKMDTDIQ
                     VSQIMEMVSNQESLNPESLAKLQMMLSNYSIGISLAGTLARKTVSAVETLLKS"
     gene            142596..143321
                     /gene="mxiJ"
                     /locus_tag="SDY_RS23945"
                     /old_locus_tag="SDY_P177"
     CDS             142596..143321
                     /gene="mxiJ"
                     /locus_tag="SDY_RS23945"
                     /old_locus_tag="SDY_P177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SctJ family type III secretion inner membrane
                     ring lipoprotein Mxi"
                     /protein_id="WP_000621939.1"
                     /translation="MIRYKFFILFLLLMLIGCEQRDELISNLSQRQANEIISVLERHN
                     ISARKVDGGKQGISVQVEKGTFASAVDLMRMYDLPNPERVDISQMFPTDSLVSSPRAE
                     KARLYSAIEQRLEQSLVSIGGVISAKIHVSYDLDDKNISSKPMHISVIAIYDSPKESE
                     LLVSNIKRFLKNTFSDVKYENISVILTPKEEYVYTNVQPVKETKSEFLINEVIYVFLG
                     MAVLVVILLVWAFKTGWFKRNKI"
     gene            143318..143845
                     /locus_tag="SDY_RS23950"
                     /old_locus_tag="SDY_P178"
     CDS             143318..143845
                     /locus_tag="SDY_RS23950"
                     /old_locus_tag="SDY_P178"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion apparatus protein OrgA/MxiK"
                     /protein_id="WP_000620626.1"
                     /translation="MIRMDGIYKKYLSIIFDPAFYINRNRLNLPSELLENGVIRSEIN
                     NLIINKYDLNCDIDPLSGVTAMFVANWNLLPAVAYFIGSQESRLINHSEMVISYYGGK
                     ISKQGEAAIRSGFWHLIAWKENISVGVYERINLLFNPIVLEGNYTPVERNLSRLNEGM
                     QYAKRHFTGIQTSCL"
     gene            143787..144482
                     /gene="mxiN"
                     /locus_tag="SDY_RS23955"
                     /old_locus_tag="SDY_P179"
     CDS             143787..144482
                     /gene="mxiN"
                     /locus_tag="SDY_RS23955"
                     /old_locus_tag="SDY_P179"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858274.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Mxi-Spa type III secretion system linker protein
                     MxiN"
                     /protein_id="WP_011378997.1"
                     /translation="MKVCNMQKGTLPVSRHHAYDGVVIKRMEKELCKTIKDRDTESKK
                     KAICVIKDATKKAESLRIDAVCDGYQIGIQTAFEHIVDYICEWKLKQNENRRNIEDYI
                     TSLLSENLHDERIISTLLEQWLSSLRNTVTELKVVLPKCNSALRKKLELDLYKYRSDV
                     KIIFKYSEGNNYIFCSGNQVVEFSPQDVISGVKIELAEKLTKNDKKYFEELAHKKLRQ
                     IAEDLLKENPVND"
     gene            144475..144882
                     /locus_tag="SDY_RS23960"
                     /old_locus_tag="SDY_P180"
     CDS             144475..144882
                     /locus_tag="SDY_RS23960"
                     /old_locus_tag="SDY_P180"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="Mxi-Spa secretion machinery protein MxiL"
                     /protein_id="WP_000609864.1"
                     /translation="MINQINASNALQQRLNSEELVNLNDRLSSSQSLDEDIIYEIMQY
                     FSQSELNPIDNDELHNKIEQLFNSRFPYLTAAQKSSLLNKLIDANQYVDLHEGFYASL
                     SIYNNINFYIKTTTFDSLISVFEAGRDADDSTW"
     gene            144866..145294
                     /gene="mxiM"
                     /locus_tag="SDY_RS23965"
                     /old_locus_tag="SDY_P181"
     CDS             144866..145294
                     /gene="mxiM"
                     /locus_tag="SDY_RS23965"
                     /old_locus_tag="SDY_P181"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858276.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system transcriptional
                     activator MxiE"
                     /protein_id="WP_011378996.1"
                     /translation="MIRHGSNKLKIFILSILLLSLSGCALKASSNSEKEWHIVPVSKD
                     YFSIPNDLFWSFNTTNKSINVYSKCISGKAVYSFNAGKFMSNFNVKEVDGCFMDAQKI
                     AIDKLFSMLKDGVVLKGNKINDTILIEKDGEVKLKLIRGL"
     gene            145424..146056
                     /gene="mxiE"
                     /locus_tag="SDY_RS23970"
                     /old_locus_tag="SDY_P182"
     CDS             145424..146056
                     /gene="mxiE"
                     /locus_tag="SDY_RS23970"
                     /old_locus_tag="SDY_P182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system transcriptional
                     activator MxiE"
                     /protein_id="WP_000398257.1"
                     /translation="MEGFFFVRNQNIKFSDNVNYHYRFNINSCAKFLAFWDYFSGALV
                     EHSHAEKCIHFYHENDLRDSCNTESMLDKLMLKFIFSSDQNVSNALAMIRMTESYHLV
                     LYLLRTIEKEKEVRIKSLTEHYGVSEAYFRTLCRKALGAKVKEQLNTWRLVNGLLDVF
                     LHNQTITSAAMNNGYASTSHFSNEIKTRLGFSARELSNITFLVKKINEKI"
     gene            146043..147743
                     /gene="mxiD"
                     /locus_tag="SDY_RS23975"
                     /old_locus_tag="SDY_P183"
     CDS             146043..147743
                     /gene="mxiD"
                     /locus_tag="SDY_RS23975"
                     /old_locus_tag="SDY_P183"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system secretin MxiD"
                     /protein_id="WP_000714402.1"
                     /translation="MKKFNVKSLTLLIVLLPLIVNANNIDSHLLEQNDIAKYVAQSDT
                     VGSFFERFSALLNYPIVVSKQAAKKRISGEFDLSNPEKMLEKLTLLVGLVWYKDGNAL
                     YIYDSGELISKVILLENISLNYLIQYLKDANLYDDRYPIRGNISDKTFYISGPPALVE
                     LVANTATLLDKQVSSIGTDKVNFGVIKLKNTFVSDRTYNMRGEDIVIPGVATVVERLL
                     NNGKALSNRQAKNDLMPPFNITQKVSEDGNDFSFSSVTNNSILEDVSLIAYPETNSIL
                     VKGNDQQIQIIRDIITQLDVAKRHIELSLWIIDIDKSELNNLGVNWQGTASFGDSFGA
                     SFNMSSSASISTLDGNKFIASVMALNQKKKANVVSRPVILTQENIPAIFDNNRTFYVS
                     LVGERNSSLEHVTYGTLINVIPRFSSRGQIEMSLTIEDGTGNSLSNYNYNNENTSVLP
                     EVGRTKISTIARVPQGKSLLIGGYTHETNSNEIVSIPFLSSIPVIGNVFKYKTSNISN
                     IVRVFLIQPREIKESSYYNTAEYKSLISEREIQKTTQIIPSETTLLEDEKSLVSYLNY
                     "
     gene            147762..148829
                     /gene="mxiC"
                     /locus_tag="SDY_RS23980"
                     /old_locus_tag="SDY_P184"
     CDS             147762..148829
                     /gene="mxiC"
                     /locus_tag="SDY_RS23980"
                     /old_locus_tag="SDY_P184"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system gatekeeper subunit
                     MxiC"
                     /protein_id="WP_000887827.1"
                     /translation="MLDVKNTGVFSSAFIDKLNAMTNSDDGDETADAELDSGLANSKY
                     IDSSDEMASALSSFINRRDLEKLKGTNSDSQERILDGEEDEINHKIFDLKRTLKDNLP
                     LDRDFIDRLKRYFKDPSDQVLALRELLNEKDLTAEQVELLTKIINEIISGSEKSVNAG
                     INSAIQAKLFGNKMKLEPQLLRACYRGFIMGNTSTTDQYIEWLGNFGFNHRHTIVNFV
                     EQSLIVDMDSEKPSCNTYEFGFVLSKLIAIKMIRTSDVIFMKKLESSSLLKDGSLSAE
                     QLLLTLLYIFQYPSESEQILTSVIEVSRASHEDSVVYQTYLSSVNESPHDIFKSESER
                     EIAINILRELVTSAYKKELSR"
     gene            148842..150902
                     /gene="mxiA"
                     /locus_tag="SDY_RS23985"
                     /old_locus_tag="SDY_P185"
                     /gene_synonym="virH"
     CDS             148842..150902
                     /gene="mxiA"
                     /locus_tag="SDY_RS23985"
                     /old_locus_tag="SDY_P185"
                     /gene_synonym="virH"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system export apparatus
                     protein MxiA"
                     /protein_id="WP_024263027.1"
                     /translation="MIQSFLKQVSTKPELIILVLMVMIIAMLIIPLPTYLVDFLIGLN
                     IVLAILVFMGSFYIERILSFSTFPSVLLITTLFRLALSISTSRLILVDADAGKIITTF
                     GQFVIGDSLAVGFVIFSIVTVVQFIVITKGSERVAEVAARFSLDGMPGKQMSIDADLK
                     AGIIDAAGAKERRSILERESQLYGSFDGAMKFIKGDAIAGIIIIFVNLIGGISVGMSQ
                     HGMSLSGALSTYTILTIGDGLVSQIPALLISISAGFIVTRVNGDSDNMGRNIMSQIFG
                     NPFVLIVTSALALAIGMLPGFPFFVFFLIAVTLTALFYYKKVVEREKSLSESDPSGYT
                     GTFDIDNSHDSSLAMIENLDAISSETVPLILLFAENKINANDMEGLIERIRSQFFIDY
                     GVRLPTILYRTSNELKVDDIVLLINEVRADSFNIYFDKVCITDENGDIDALGIPVVPT
                     SYNERVISWVDVSYTENLTNIDAKIKSAQDEFYYQLSQALLNNINEIFGIQETKNMLD
                     QFENRYPDLLKEVFRHVTIQRISEVLQRLLGENISVRNLKLIMESLALWAPREKDVIT
                     LVEHVRASLSRYICSKIAVSGEIKVVMLSGYIEDAIRKGIRQTSGGSFLNMDIEVSDE
                     VMETLAHALRELRNAKKDFVLLVSVDIRRFVKRLIDNRFKSILVISYAEIDEAYTINV
                     LKTI"
     gene            150915..151316
                     /gene="spa15"
                     /locus_tag="SDY_RS23990"
                     /old_locus_tag="SDY_P186"
                     /gene_synonym="spaK"
     CDS             150915..151316
                     /gene="spa15"
                     /locus_tag="SDY_RS23990"
                     /old_locus_tag="SDY_P186"
                     /gene_synonym="spaK"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system chaperone Spa15/SpaK"
                     /protein_id="WP_011378994.1"
                     /translation="MSNINLVQLVRDSLFTIGCPPSIITDLDSHSAITISLDNMPAIN
                     IALVNEQVMLWANFDAPSDVKLQSSAYNILNLMLMNFSYSINELVELHRSDEYLQLRV
                     VIKDDYVHDGIVFAEILHEFYQRMEILNEVL"
     gene            151320..152612
                     /gene="spaL"
                     /locus_tag="SDY_RS23995"
                     /old_locus_tag="SDY_P187"
                     /gene_synonym="mxiB; spa47"
     CDS             151320..152612
                     /gene="spaL"
                     /locus_tag="SDY_RS23995"
                     /old_locus_tag="SDY_P187"
                     /gene_synonym="mxiB; spa47"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system ATPase SpaL"
                     /protein_id="WP_000122614.1"
                     /translation="MSYTKLLTQLSFPNKISGPILETSLSDVSIGEICNIQAGIESNE
                     IVARAQVVGFHDEKTILSLIGNSRGLSRQTLIKPTAQFLHTQVGRGLLGAVVNPLGEV
                     TDKFAVTDNSEILYRPVDNAPPLYSERAAIEKPFLTGVKVIDSLLTCGEGQRMGIFAS
                     AGCGKTFLMNMLIEHSGADIYVIGLIGERGREVTETVDYLKNSEKKSRCVLVYATSDY
                     SSVDRCNAAYIATAIAEFFRTEGHKVALFIDSLTRYARALRDVALAAGESPARRGYPV
                     SVFDSLPRLLERPGKLKAGGSITAFYTVLLEDDDFADPLAEEVRSILDGHIYLSRNLA
                     QKGQFPAIDSLKSISRVFTQVVDEKHRIMAAAFRELLSEIEELRTIIDFGEYKPGENA
                     SQDKIYNKISVVESFLKQDYRLGFTYEQTMELIGETIR"
     gene            152705..153043
                     /gene="spa13"
                     /locus_tag="SDY_RS24000"
                     /old_locus_tag="SDY_P188"
                     /gene_synonym="spaM"
     CDS             152705..153043
                     /gene="spa13"
                     /locus_tag="SDY_RS24000"
                     /old_locus_tag="SDY_P188"
                     /gene_synonym="spaM"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858283.1"
                     /note="Not similar to SpaM from Salmonella T3SS; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system protein Spa13"
                     /protein_id="WP_024263028.1"
                     /translation="MEALDKRIIYFLQLENDLEPVGAQSVSQLFNTRRKIAIVKKHII
                     QYQSERIILKGRIEEIQKDIDEANASKRKLLHKESKICKRISLIKRNNFAKQLILDEL
                     SQEDMKHGIR"
     gene            153030..153908
                     /gene="spa32"
                     /locus_tag="SDY_RS24005"
                     /old_locus_tag="SDY_P189"
     CDS             153030..153908
                     /gene="spa32"
                     /locus_tag="SDY_RS24005"
                     /old_locus_tag="SDY_P189"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system needle length
                     regulator Spa32"
                     /protein_id="WP_001162452.1"
                     /translation="MALDNINLNFSSDKQIEKCEKLSSIDNIDSLVLKKKRKVEIPEY
                     SLIASNYFTIDKHFEHKHDKGEIYSGIKNAFELRNERATYSDILESMVIKENILIPVQ
                     DIKAREKINIGDMRGIFSYNESGNADKNFERSHTSSANPDNLLEPDNRNSQIGLKNHS
                     LSIDKNIADIISLLNGSVAKSFDLPVMKKNTSDITPSMSLQEKSIVENDKNVYQKNSE
                     MTYHFKQWGAGHSVSISVESGSFVLKPSDQFVGNKLDLILKQDAEGNYRFDSSQHNKG
                     NKNNSTGYNEQSEEEC"
     gene            153902..154783
                     /gene="spaO"
                     /locus_tag="SDY_RS24010"
                     /old_locus_tag="SDY_P190"
     CDS             153902..154783
                     /gene="spaO"
                     /locus_tag="SDY_RS24010"
                     /old_locus_tag="SDY_P190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000944309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SctQ family type III secretion system ring
                     protein Spa33"
                     /protein_id="WP_000944986.1"
                     /translation="MLRLKHFDANEKLQILYAKQLCERFAIQTFKNKFTGSESLVTLT
                     SVCGDWVIRIDTLSFLKKKYEVFSGFSTQESLLHLSKCVFIESSSVFSIPELSDKITF
                     RITNEIQFATTGSHLCCFSSSLGIIYLDKMPVLRNQVSLDLLHHLLEFCLGSSNVRLA
                     TLKRIRTGDIIIVQKLYNLLLCNQVIIGDYIVNDNNEAKINLSESNGESDHTEVSLAL
                     FNYDDINVKVDFILLEKKMTINELKMYVENELFKFPDDIVKHVNIKVNGSLVGHGELV
                     SIEDGYGIEISSWMVKE"
     gene            154788..155438
                     /gene="spa24"
                     /locus_tag="SDY_RS24015"
                     /old_locus_tag="SDY_P191"
                     /gene_synonym="spaP"
     CDS             154788..155438
                     /gene="spa24"
                     /locus_tag="SDY_RS24015"
                     /old_locus_tag="SDY_P191"
                     /gene_synonym="spaP"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system export apparatus
                     protein Spa24/SpaP"
                     /protein_id="WP_000947538.1"
                     /translation="MLSDMSLIATLSFFTLLPFLVAAGTCYIKFSIVFVMVRNALGLQ
                     QVPSNMTLNGIALIMALFVMKPIIEAGYENYLNGPQKFDTISDIVRFSDSGLIEYKQY
                     LKKHTDLELARFFQRSEEENADLKSAENNDYSLFSLLPAYALSEIKDAFKIGFYLYLP
                     FIVVDLVISSILLALGMMMMSPITISVPIKLVLFVALDGWGILSKALIEQYINVPA"
     gene            155453..155713
                     /gene="spaQ"
                     /locus_tag="SDY_RS24020"
                     /old_locus_tag="SDY_P191a"
     CDS             155453..155713
                     /gene="spaQ"
                     /locus_tag="SDY_RS24020"
                     /old_locus_tag="SDY_P191a"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system export apparatus
                     protein SpaQ"
                     /protein_id="WP_001280546.1"
                     /translation="MSDIVYMGNKALYLILIFSLWPVGIATVIGLTIGLLQTVTQLQE
                     QTLPFGIKLIGVSISLLLLSGWYGEVLLSFCHEIMFLIKSGV"
     gene            155713..156483
                     /gene="spa29"
                     /locus_tag="SDY_RS24025"
                     /old_locus_tag="SDY_P192"
                     /gene_synonym="spaR"
     CDS             155713..156483
                     /gene="spa29"
                     /locus_tag="SDY_RS24025"
                     /old_locus_tag="SDY_P192"
                     /gene_synonym="spaR"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858288.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system export apparatus
                     protein Spa29/SpaR"
                     /protein_id="WP_000355395.1"
                     /translation="MDISSWFESIHVFLILLNGVFFRLAPLFFFLPFLNNGIISPSIR
                     IPVIFLVASGLITSGKVDIGSSVFEHVYFLMFKEIIVGLLLSFCLSLPFWIFHAVGSI
                     IDNQRGATLSSSIDPANGVDTSELAKFFNLFSAVVFLYSGGMVFILESIQLSYNICPL
                     FSQCSFRVSNILTFLTLLASQAVILASPVMIVLLLSEVLLGVLSRFAPQMNAFSVSLT
                     IKSLLAIFIIFICSSTIYFSKVQFFLGEHKFFTNLFVR"
     gene            156490..157518
                     /gene="spa40"
                     /locus_tag="SDY_RS24030"
                     /old_locus_tag="SDY_P193"
                     /gene_synonym="spaS"
     CDS             156490..157518
                     /gene="spa40"
                     /locus_tag="SDY_RS24030"
                     /old_locus_tag="SDY_P193"
                     /gene_synonym="spaS"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system export apparatus
                     switch protein Spa40/SpaS"
                     /protein_id="WP_001284685.1"
                     /translation="MANKTEKPTPKKLKDAAKKGQSFKFKDLTTVVIILVGTFTIISF
                     FSLSDVMLLYRYVIINDFEINEGKYFFAVVIVFFKIIGFPLFFCVLSAVLPTLVQTKF
                     VLATKAIKIDFSVLNPVKGLKKIFSIKTIKEFFKSILLLIILALTTYFFWINDRKIIF
                     SQVFSSVDGLYLIWGGLFKDIILFFLAFSIFVIILDFVIEFILYMKDMMMDKQEIKRE
                     YIEQEGHFETKSRRRELHIEILSEQTKSDIRNSKLVVMNPTHIAIGIYFNPEIAPAPF
                     ISLIETNQCALAVRKYANEVGIPTVRDVKLARKLYKTHTKYSFVDFEHLDEVLRLIVW
                     LEQVENTH"
     gene            157531..157773
                     /locus_tag="SDY_RS24035"
                     /old_locus_tag="SDY_P194"
     CDS             157531..157773
                     /locus_tag="SDY_RS24035"
                     /old_locus_tag="SDY_P194"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010921676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010921676.1"
                     /translation="MCYMGVNFCNKIGIDQSEFEIESSIINSIANEVLNPISFLSNKD
                     IINVLLRKISSECDLVRKDIYRCALELVVEKTPDDL"
     gene            complement(158350..>159221)
                     /locus_tag="SDY_RS24040"
                     /old_locus_tag="SDY_P195"
                     /pseudo
     CDS             complement(158350..>159221)
                     /locus_tag="SDY_RS24040"
                     /old_locus_tag="SDY_P195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611999.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            complement(<159218..159797)
                     /locus_tag="SDY_RS24545"
                     /pseudo
     CDS             complement(<159218..159797)
                     /locus_tag="SDY_RS24545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477168.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(159860..160264)
                     /locus_tag="SDY_RS24055"
     CDS             complement(159860..160264)
                     /locus_tag="SDY_RS24055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858300.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_038815643.1"
                     /translation="MNTALIVALMCMWYAVPAAAKETLLAMPRNSTEHCYAEINVHGP
                     YGVYFRVVPHPPGGKSWVECNSDYYYSDKPPGVQILGTRAGCRVYGICGTTSTLHVAG
                     RGVVCIKNICSPRRMIIHRIRKRPVVAVSDEM"
     gene            complement(160815..161531)
                     /locus_tag="SDY_RS24060"
                     /old_locus_tag="SDY_P198"
     CDS             complement(160815..161531)
                     /locus_tag="SDY_RS24060"
                     /old_locus_tag="SDY_P198"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005059327.1"
                     /translation="MNDNSLLRNSSLFIAYMGCVGWVSAYSYGWGTSFYYGFPWWVVG
                     AGLDDVARSLLYAIIVMGILFTGWGIGILFFLLIKKRSKIQDLSFFRLFFAITLLFFP
                     VIFELLILKQYFILPLSLSCIISSLVISIIIRIYGRIFSVSCFSDIPFVREHRIKLIM
                     AGFLVYFWLFSFLVGWYKPQLKKEYQMLCYNNSWYYVLARYDSRLVLSSSFKDDSNRF
                     LIFNTEQSGFYEINDVYVRK"
     gene            complement(162115..>162522)
                     /locus_tag="SDY_RS24065"
                     /pseudo
     CDS             complement(162115..>162522)
                     /locus_tag="SDY_RS24065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003912930.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
     gene            complement(162546..>163007)
                     /locus_tag="SDY_RS24070"
                     /old_locus_tag="SDY_P201"
                     /pseudo
     CDS             complement(162546..>163007)
                     /locus_tag="SDY_RS24070"
                     /old_locus_tag="SDY_P201"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000343760.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            163060..164269
                     /locus_tag="SDY_RS24075"
                     /pseudo
     CDS             163060..164269
                     /locus_tag="SDY_RS24075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_086558238.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     misc_feature    163341..163457
                     /locus_tag="SDY_RS24075"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF01497"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="AL1L pseudoknot; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /pseudo
                     /db_xref="RFAM:RF01497"
     gene            complement(<164296..>164445)
                     /locus_tag="SDY_RS24080"
                     /pseudo
     CDS             complement(<164296..>164445)
                     /locus_tag="SDY_RS24080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000343765.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus and C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(164626..>165055)
                     /locus_tag="SDY_RS24085"
                     /old_locus_tag="SDY_P204"
                     /pseudo
     CDS             complement(164626..>165055)
                     /locus_tag="SDY_RS24085"
                     /old_locus_tag="SDY_P204"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013747467.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing N-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(165211..165468)
                     /locus_tag="SDY_RS24090"
                     /old_locus_tag="SDY_P205"
     CDS             complement(165211..165468)
                     /locus_tag="SDY_RS24090"
                     /old_locus_tag="SDY_P205"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000124081.1"
                     /translation="MARSAKPRKRKPAPQRSKLLRYVVKLHEDDFFDEEEAEVLRFDN
                     FDDAVECCADLNIPFFVDAGNKKLVFWFVRVDDEGYPEIAR"
     gene            complement(<166221..>166619)
                     /locus_tag="SDY_RS24550"
                     /pseudo
     CDS             complement(<166221..>166619)
                     /locus_tag="SDY_RS24550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_708749.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing N-terminus and C-terminus;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="group II intron reverse transcriptase/maturase"
     gene            complement(<166622..>166988)
                     /locus_tag="SDY_RS24100"
                     /pseudo
     CDS             complement(<166622..>166988)
                     /locus_tag="SDY_RS24100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477168.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus and C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            complement(<166990..167674)
                     /locus_tag="SDY_RS24105"
                     /pseudo
     CDS             complement(<166990..167674)
                     /locus_tag="SDY_RS24105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_086558238.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     misc_feature    complement(167277..167393)
                     /locus_tag="SDY_RS24105"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF01497"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="AL1L pseudoknot; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /pseudo
                     /db_xref="RFAM:RF01497"
     gene            complement(167852..169054)
                     /gene="virA"
                     /locus_tag="SDY_RS24110"
                     /old_locus_tag="SDY_P211"
     CDS             complement(167852..169054)
                     /gene="virA"
                     /locus_tag="SDY_RS24110"
                     /old_locus_tag="SDY_P211"
                     /EC_number="3.4.22.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858314.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-tubulin-specific protease"
                     /protein_id="WP_001195011.1"
                     /translation="MQTSNITNYERNDSSWMSTVKSTTEVSWNKLSFCDVLLKIITFG
                     IYSPHETLAEKYSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYL
                     DGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAIN
                     CCTSIIPNDDYFSVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINE
                     LGINEFIDSKKELQMLSYNQVNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTS
                     AFWQSLHITSSSVEHIYAQIMSENIENRLNFMPEQRVINNCGHIIKINAVVPKNDTAI
                     SASGGRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVS
                     FAIISPDV"
     gene            complement(169389..170083)
                     /locus_tag="SDY_RS24115"
     CDS             complement(join(169389..169837,169837..170083))
                     /locus_tag="SDY_RS24115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477181.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS1-like element IS1N family transposase"
                     /protein_id="WP_087786203.1"
                     /translation="MASVNIHCPRCQSAQVYRHGQNPKGHDRFRCRDCHRVFQLTYTY
                     EARKPGIKELITEMAFNGAGVRDTARTLKIGINTVIRTFKKLTPKRITSSPVAHADVA
                     LICELDEQWSFVGSKARQHWLWYAYNTKTGGVLAYTFGPRTDETCRELLALLTPFNIG
                     MITSDDWGSYGREVPKDKHLTGKIFTQRIERNNLTLRTRIKRLARKTICFSRSVEIHE
                     KVIGTFIEKHMFY"
     gene            170357..173665
                     /gene="icsA"
                     /locus_tag="SDY_RS24120"
                     /old_locus_tag="SDY_P214"
                     /gene_synonym="virG"
     CDS             170357..173665
                     /gene="icsA"
                     /locus_tag="SDY_RS24120"
                     /old_locus_tag="SDY_P214"
                     /gene_synonym="virG"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane autotransporter IcsA"
                     /protein_id="WP_001071790.1"
                     /translation="MNQIHKFFCNMTQCSQGGAGELPTVKEKTCKLSFSPFVVGAFLL
                     LGGPIAFAIPLSGTQELHFSEDNYEKLLTPVDGLSPLGAGEDGMDAWYITSSNPSHAS
                     RTKLRINSDIMISAGHGGAGDNNDGNSCGGNGGDSITGSDLSIINQGMILGGSGGSGA
                     DHNGDGGEAVTGDNLFIINGEIISGGHGGDSYSDSDGGNGGDAVTGVNLPIINKGTIS
                     GGNGGNNYGEGDGGNGGDAITGSSLSVINKGTFAGGNGGAAYGYGYDGYGGNAITGDN
                     LSIINNGAILGGNGGHWGDAINGSNMTIANSGYIISGKEDDGTQNVAGNAIHITGGNN
                     SLILHEGSVITGDVQVNNSSILKIINNDYTGTTPTIEGDLCAGDCTTVSLSGNKFTVS
                     GDVSFGENSSLNLAGISSLEASGNMSFGNNVKVEAIINNWAQKDYKLLSADKGITGFS
                     VSNISIINPLLTTGAIDYTKSYISDQNKLIYGLSWNDTDGDSHGEFNLKENAELTVST
                     ILADNLSHHNINSWDGKSLTKSGEGTLILAEKNTYSGFTNINAGILKMGTVEAMTRTA
                     GVIVNKGATLNLSGMNQTVNTLLNSGTVLINNINAPFLPDPVIVTGNMTLEKNGHVIL
                     NNSSSNVGQTYVQKGNWHGKGGILSLGAVLGNDNSKTDRLEIAGHASGITYVAVTNEG
                     GSGDKTLEGVQIISTDSSDKNAFIQKGRIVAGSYDYRLKQGTVSGLNTNKWYLTSQMD
                     NQESKQMSNQESTQMSSRRASSQLVSSLNLGEGSIHTWRPEAGSYIANLIAMNTMFSP
                     SLYDRHGSTIVDPTTGQLSETTMWIRTVGGHNEHNLADRQLKTTANRMVYQIGGDILK
                     TNFTDHDGLHVGIMGAYGYQDSKTHNKYTSYSSRGTVSGYTAGLYSSWFQDEKERTGL
                     YMDAWLQYGWFNNTVKGNGLTGEKYSSKGITGALEVGYIYPTIRWTAHNNIDNALYLN
                     PQVQITRHGVKANDYIEHNGTMVTSSGVNNIQAKLGLRTSLISQSCIDKETLRKFEPF
                     LEVNWKWSSKQYGVIMNGMSNHQIGNRNVIELKTGVGGRLADNLSIWGNVSQQLGNNS
                     YRDTQGILGVKYTF"
     gene            complement(173891..175119)
                     /locus_tag="SDY_RS24125"
                     /old_locus_tag="SDY_P215"
     CDS             complement(join(173891..174804,174804..175119))
                     /locus_tag="SDY_RS24125"
                     /old_locus_tag="SDY_P215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_086558215.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-like element IS2 family transposase"
                     /protein_id="WP_088895425.1"
                     /translation="MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAAS
                     QLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVE
                     YGRGKKVDSARALIARGWGVSLVSRCLRVSRAQLHVILRRTDDWMDGRRSRHTDDTDV
                     LLRIHHVIGELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLERKPAVP
                     PSKRAHTGRVAVKESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFN
                     SETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRS
                     PESNGIAESFVKTIKRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREY
                     LRQRACNGLSDNRCLEI"
     gene            175183..175374
                     /locus_tag="SDY_RS24130"
     CDS             175183..175374
                     /locus_tag="SDY_RS24130"
                     /inference="COORDINATES: protein motif:HMM:NF012786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria/pilus outer membrane usher protein"
                     /protein_id="WP_134801818.1"
                     /translation="MSGDSGGQSTNARVVVSQQGRVIYDSTVPAGTFSIQDLGPYDHQ
                     PESRCRRRPRKPSVRGRTT"
     gene            <175298..175876
                     /locus_tag="SDY_RS24135"
                     /old_locus_tag="SDY_P217"
                     /pseudo
     CDS             <175298..175876
                     /locus_tag="SDY_RS24135"
                     /old_locus_tag="SDY_P217"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612086.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            complement(<175915..>176055)
                     /locus_tag="SDY_RS24140"
                     /pseudo
     CDS             complement(<175915..>176055)
                     /locus_tag="SDY_RS24140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000952428.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus and C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS21 family transposase"
     gene            <176051..>176206
                     /locus_tag="SDY_RS24145"
                     /old_locus_tag="SDY_P218"
                     /pseudo
     CDS             <176051..>176206
                     /locus_tag="SDY_RS24145"
                     /old_locus_tag="SDY_P218"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000907654.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus and C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
     gene            176278..176538
                     /gene="repA"
                     /locus_tag="SDY_RS24150"
                     /old_locus_tag="SDY_P219"
     CDS             176278..176538
                     /gene="repA"
                     /locus_tag="SDY_RS24150"
                     /old_locus_tag="SDY_P219"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000078110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication regulatory protein RepA"
                     /protein_id="WP_000078111.1"
                     /translation="MSQIENAVTSSPKRIYRKGNPLTGAEKQRISVSRKKGTHKAINV
                     FIQSELKDDLTQLCKDSGLTQKEMIEHWILKEKAAVDDANRR"
     gene            176773..176847
                     /gene="tap"
                     /locus_tag="SDY_RS24155"
     CDS             176773..176847
                     /gene="tap"
                     /locus_tag="SDY_RS24155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001370046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RepA leader peptide Tap"
                     /protein_id="WP_001365705.1"
                     /translation="MPGKVQDFFLCSLLLRIVSAGWCD"
     gene            176840..177697
                     /gene="repA"
                     /locus_tag="SDY_RS24160"
                     /old_locus_tag="SDY_P220"
     CDS             176840..177697
                     /gene="repA"
                     /locus_tag="SDY_RS24160"
                     /old_locus_tag="SDY_P220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858393.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="incFII family plasmid replication initiator
                     RepA"
                     /protein_id="WP_000131021.1"
                     /translation="MTDLQQTYYRQVKNPNPVSTPREGARTLPFCGKLMEKAVGFTSR
                     FDFAIHVAHARSLGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECG
                     LATESDAGTLSITRATRALTFLAELGLITYQTEYDPLIGCNIPTDITFTPALFAALDV
                     SEEAVASARRSRVEWENRQRKKQGLDTLGMDELMAKAWRFVRERFRSYQTELKSRGMK
                     RARARRDADRQRQDIVTLVKRQLTREISEGRFTASREAVKREVERRVKERMILSRNRN
                     YSRLATASP"
     gene            178245..178718
                     /locus_tag="SDY_RS24165"
     CDS             178245..178718
                     /locus_tag="SDY_RS24165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014526575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001217111.1"
                     /translation="MRIDISNQTRRTPPDMLPREQNCVAMALSACFRQQLNPVVNSLL
                     KERIIHSPKELEHDYAVIRTLQKLQIQEVCNNTFWETAKQQLIQKPDGRYFAINSKQL
                     AFPGSGESHAFCCIKYKNAIGINGNNAENHSTHYQPYPHDKVSIWGPFPEPDLAI"
     gene            <178791..>178990
                     /locus_tag="SDY_RS24170"
                     /pseudo
     CDS             <178791..>178990
                     /locus_tag="SDY_RS24170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000080195.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus and C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(179127..179819)
                     /gene="ospZ"
                     /locus_tag="SDY_RS24175"
                     /old_locus_tag="SDY_P221"
     CDS             complement(179127..179819)
                     /gene="ospZ"
                     /locus_tag="SDY_RS24175"
                     /old_locus_tag="SDY_P221"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000625270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system effector cysteine
                     methyltransferase OspZ"
                     /protein_id="WP_000625266.1"
                     /translation="MISPIKNIKNVFPINTANTEYIVRNIYPRVEHGYFNESPNIYDK
                     KYISGITRSMAQLKIEEFINEKSRRLNYMKTMYSPCPEDFQPISRDEASTPEGSWLTV
                     ISGKRPMGQFSVDSLYHPDLHALCELPEISCKIFPKENSDFLYIIVVFRNDSPQGELR
                     ANRFIELYDIKREIMQVLRDESPELKSIKSEIIIAREMGELFSYASEEIDSYIKQMND
                     RLSQIKARMPVT"
     gene            <179875..180027
                     /locus_tag="SDY_RS24180"
                     /old_locus_tag="SDY_P222"
                     /pseudo
     CDS             <179875..180027
                     /locus_tag="SDY_RS24180"
                     /old_locus_tag="SDY_P222"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012477168.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            complement(180309..180446)
                     /locus_tag="SDY_RS24185"
                     /old_locus_tag="SDY_P223"
     CDS             complement(180309..180446)
                     /locus_tag="SDY_RS24185"
                     /old_locus_tag="SDY_P223"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011378983.1"
                     /translation="MTTTELFWDLNAIKWLVEGRGDDVSPFENIPVPDLTYNKEAWQF
                     G"
     gene            181408..182355
                     /gene="icsP"
                     /locus_tag="SDY_RS24190"
                     /old_locus_tag="SDY_P224"
     CDS             181408..182355
                     /gene="icsP"
                     /locus_tag="SDY_RS24190"
                     /old_locus_tag="SDY_P224"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858404.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="omptin family outer membrane protease IcsP"
                     /protein_id="WP_011378982.1"
                     /translation="MKLKFLVLALCVPAIFTTHATTNYPLFIPDNISTDISLGSLSGK
                     TKERVYHPKEGGRKISQLDWKYSNATIVRGGIDWKLIPKVSFGVSGWTTLGNQKASMV
                     DKDWNNSNTPQIWTDQSWHPNTHLRDANEFELNLKGWLLNNLDYRLGLIAGYQESRYS
                     FNAMGGSYIYSENGGNRNKKGAHPSGERTIGYKQLFKIPYIGLTANYRHENFEFGAEL
                     KYSGWVRSSDTDKHYQTETIFKDEIKNQNYRSVAANIGYYVTPSAKFYIEGSRNYISN
                     KKGDTSLYEQSTNISGTIKNSASIEYIGFLTSAGIKYIF"
CONTIG      join(CP000035.1:1..182726)
//
DBGET integrated database retrieval system