GenomeNet

Database: RefSeq
Entry: NC_009449
LinkDB: NC_009449
Original site: NC_009449 
LOCUS       NC_009449               1336 bp ss-DNA     circular VRL 13-AUG-2018
DEFINITION  Honeysuckle yellow vein beta-[Japan:Fukui:2001], complete genome.
ACCESSION   NC_009449
VERSION     NC_009449.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Honeysuckle yellow vein beta-[Japan:Fukui:2001]
  ORGANISM  Honeysuckle yellow vein beta-[Japan:Fukui:2001]
            Viruses; Tolecusatellitidae; Betasatellite; unclassified
            Betasatellite.
REFERENCE   1
  AUTHORS   Ueda,S., Onuki,M., Hanada,K. and Takanami,Y.
  TITLE     Unique grouping of the Far East Asian begomovirus complex based on
            sequence analyses of the DNA-A genome and associated DNAbeta
            satellite molecules isolated from tomato, honeysuckle and
            Eupatorium plants in Japan
  JOURNAL   Arch. Virol. 153 (3), 417-426 (2008)
   PUBMED   18175045
REFERENCE   2  (bases 1 to 1336)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-MAY-2007) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1336)
  AUTHORS   Ueda,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-SEP-2005) Contact:Shigenori Ueda National
            Agricultural Institute for Kyushu Okinawa Region; 1823 Mii, Kurume,
            Fukuoka 839-8503, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AB236322.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1336
                     /organism="Honeysuckle yellow vein
                     beta-[Japan:Fukui:2001]"
                     /mol_type="genomic DNA"
                     /isolate="Fukui"
                     /isolation_source="tomato"
                     /db_xref="taxon:435486"
                     /country="Japan: Fukui"
                     /collection_date="2001"
                     /note="DNA beta, satellite molecule associated with
                     Tobacco leaf curl Japan virus;
                     originally submitted as 'Tobacco leaf curl Japan
                     virus-[Fukui]-associated DNA beta'"
     gene            complement(207..557)
                     /gene="betaC1"
                     /locus_tag="HYVBV2001_gp1"
                     /db_xref="GeneID:5129797"
     CDS             complement(207..557)
                     /gene="betaC1"
                     /locus_tag="HYVBV2001_gp1"
                     /codon_start=1
                     /product="C1 protein"
                     /protein_id="YP_003706632.1"
                     /db_xref="GeneID:5129797"
                     /translation="MTIIYNNGKGIKFIIDVRLQQFIRVQVQVYSTNQPVLTGIRCNI
                     PYTYVHMNPPFDFNGTEELVRDTLELMYDESDISNFKQEEMIDSIDIVMMHWLSDMGV
                     DTVDKYVVRNRYTV"
     misc_feature    complement(210..554)
                     /gene="betaC1"
                     /locus_tag="HYVBV2001_gp1"
                     /note="Beta-satellite pathogenicity beta C1 protein;
                     Region: Pathogen_betaC1; pfam09593"
                     /db_xref="CDD:150305"
ORIGIN      
        1 accggtggcg agttggggga ctcgggggaa aggtgggccc cacctttctg tataagtttt
       61 ggtttattgc actctgagtc cctgtacttt gtcctattca tttttatacc ctaaaaatga
      121 atttaatgaa gaataaaaat aaaattaatc attaatttta tttacacgga gatatgcaat
      181 acattgctta tcgtagtaca tggtagttat acggtatatc tattccgtac aacatattta
      241 tctactgtat ctacccccat atcacttaac cagtgcatca tcacgatatc aattgaatca
      301 atcatctctt cttgtttgaa attggagatg tctgactcat cgtacatcaa ttccagtgta
      361 tccctgacta gctcctctgt cccgttgaag tcgaaagggg gattcatatg gacgtatgtg
      421 tatggtatgt tgcagcgtat acctgttagt accggttgat tcgttgagta tacctggacc
      481 tgcactctga tgaactgttg gagccttacg tctatgatga acttgatgcc cttgccgttg
      541 ttatatatta tcgtcatctc atcatgctgg atctatggtc atctatctat gtccttttat
      601 agagtggtga tttgtgggtt gtgtgtctca atttggtcca tgtatttgtg cttatttgtt
      661 cttggaagta ttgtttccta ttaattctgc tatccatcct ttatttctga aagaaaatag
      721 aaagagaaaa agaaaaatgg aatcaaagag aaaagaaaat gaaaacaaaa aaagaaccca
      781 acacaaaaat agacaaataa atatagaaaa gaacacctat tccggcataa agggagcgca
      841 gctcaagtgt caaaaaaaaa atagaaaaga aatggagaaa aaaaaagaag aaaaaagaaa
      901 tacttgaacg aagtgaaaat aaaattaaaa tagaaataag aaaataatta aatgaagccc
      961 aaaaacaatt tatctcggaa aaagcccaaa taaatacccg gcccatgacc caatttgaat
     1021 ttgactgttc accataatta caataatgcc atgcccccca gtgcccccca attgcccccc
     1081 gattcaatcg ggggacactt atccgtacat tttaattgga caacaatacc cctgaaaagc
     1141 agagataaca ggcgcgtggg agtgccctgt aaaagtgctt ttctctctcc tcaaaccccc
     1201 cggagacgat gatcggaggc cttccggtca tcattttccg acacgcgcgg cagtgcgaac
     1261 acggatgtgg gcaaaccact acgctacgca gcagccttag ctacgccgga gcctagctcg
     1321 ccaccgttat aatatt
//
DBGET integrated database retrieval system