KEGG   Cupriavidus pinatubonensis JMP134: Reut_A3076
Entry
Reut_A3076        CDS       T00268                                 

Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit apoprotein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00230  Purine metabolism
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Reut_A3076
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Reut_A3076
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AAZ62436
UniProt: Q46WP7
Position
1:3385679..3387952
AA seq 757 aa
MTHAVIGHSVKRTDLLDKVTGNAKYVADMPFAGLLFGKIKRCEVAHAKIRRIDTSRALAL
PGVKAVLTHENVPRVLHAGSPHPRSASVTCDQYILDDKVRYWGEGVAAVAATSEDIAAHA
IELIEVEYETLPAVFTTEDAERSDAPRIHDREPGGNLVLPPVIVKRGDVEAGFAEADFIL
EGIYEGGRPTPAYMEPNVCTCNWDGNGNLTVWISTQTAFMVRGIMAEVLGLPLHKVRVLV
DHMGGGFGAKQDLFQHEFLCALMARETRRPVRMEYTREETFLGGRTRHPARIWLKQGFRN
DGTITARQAKVVFNSGAYGSHGPGVTNVGTAAMVSLYRCDNVLLEGRCVYTNSPIAGAFR
GYGVVQTYYALDVQMDEAAEHLGMDPADLKLKNAVREGDIAPSNHPLIGHGLEACISKGM
EATRWAALRQRPRDTEGPIRTGWGIGCEMHGSSAYPGIKEQGNAIIKMNEDGTVVLLTGA
AGLGTGAHTALAQIVAEELTLPFESVSVVHGDTDVVPWDIGAFASHTTYMVGKAAQMAAG
EIKRQLFDRAAKLLECTPDALMLTAGVIAVRDREGPTLTVREAVMPRKGIPAAQLVGTAT
YHPTKSYSFAAHFVQVEVDTETGFITVKQVVPVHDVGKVIHPVAAAGQIEGGIQQGIGHT
LYEDYQIDMRTGRSLNANFVDYKMPLAMDMPEIHTIILEAAPDPGGPFGAKGVGEDPIVA
IGPAISNAVFDAIGVRFRHYPIRPEQVLQALAKKAAA
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgacccacgccgtgatcggacacagcgtcaagcgcaccgacctgctcgacaaggtcacc
ggcaatgcgaagtacgttgccgacatgccgttcgccggcctgctgttcggcaagatcaag
cgctgcgaagtcgcgcacgcaaagatccgccgcatcgacacatcgcgcgcgcttgcgctg
cccggcgtcaaggccgtgctcacccacgagaacgtgccgcgcgtgttgcatgccggatcg
ccgcatccgcgctctgcgtcagtgacgtgcgaccagtacatcctcgacgacaaggtgcgc
tactggggcgaaggcgtggccgccgtggccgcgactagcgaggacatcgcggcgcatgcg
atcgaactgatcgaagtcgaatacgagacgctgcccgccgtattcacgacagaagatgcc
gaacgttccgacgcgccgcgcatccacgaccgcgaacccggcggcaacctggtgttgccg
cctgtcatcgtcaagcgcggtgatgtcgaagccggctttgccgaagcggatttcatcctc
gaaggcatctatgaaggcggccgccctaccccggcctacatggaaccgaacgtctgcacc
tgcaactgggacggcaacggcaatctgaccgtgtggatttccacgcagaccgcgttcatg
gtacgcggcatcatggccgaagtgctgggcctgccgctgcacaaggtacgcgtgctggtc
gaccatatgggcggcggctttggtgcgaagcaagacctgtttcagcatgagtttctgtgc
gcattgatggcgcgcgagacgcgccggccggtgcgcatggaatacacgcgcgaggaaacc
ttcctcggcggacgcacacgccatccggccaggatctggctcaagcagggcttccgcaac
gacggcaccatcactgcgcgccaggcgaaggtggtgttcaactcgggcgcgtatggctcg
catggtcccggcgtcaccaacgtcggcaccgcagccatggtctcgctgtaccgctgcgac
aacgtgctgctcgaagggcgttgcgtctacaccaacagcccgatcgcgggcgcgttccgt
ggctatggcgtggtgcagacctactatgcgctcgatgtccagatggacgaggcggccgaa
catctcggcatggaccccgccgacctaaaactgaagaacgccgtgcgcgaaggcgatatc
gcaccgtccaatcacccgctcatcggccacgggctggaagcatgcatcagcaagggcatg
gaagccacccgttgggccgcactgcgacagcgcccacgcgatacggaaggcccgatccgc
accggctggggcatcggttgcgagatgcacggcagcagcgcctatccgggcatcaaggag
cagggcaacgcgatcatcaagatgaacgaggatggcaccgtcgtgctgctgacgggtgct
gcaggccttggcacgggagcgcatacggcgctcgcgcaaatcgtggcagaggaactgacg
ctgccgttcgagtcggtgtctgtggtccacggcgataccgatgtggtgccgtgggacatc
ggcgccttcgcgagccatacgacgtacatggtcggcaaggctgcgcagatggcggcgggc
gagatcaagcggcaactgttcgatcgcgcggcgaagctgctcgaatgcacccctgatgca
ttgatgctcacggctggcgtgatcgcggtgcgcgaccgcgaaggtccaacgctgacggtg
cgcgaagcagtcatgccacgcaagggtattcctgccgcgcaactggtcggcaccgccaca
taccacccgaccaagtcgtattcgttcgccgcgcatttcgtgcaagtcgaagtcgacacg
gaaacgggcttcattaccgtgaagcaggtagtgcccgtgcatgacgtcggcaaggtgatc
caccccgtggcggcggccggccagatcgagggtggcatccagcaaggcatcggccatacg
ctgtacgaggactaccagatcgacatgcgcaccggccgctcgctcaatgccaacttcgtc
gactacaagatgccgctcgcgatggacatgccggagattcacaccatcatccttgaagcg
gcccccgatcctggcggaccgttcggcgccaagggcgtaggggaggatccgatcgtcgcg
atcggaccggccatttccaacgccgtgttcgatgcgatcggcgtgcgcttccggcactac
ccgatccggccggagcaggtgctgcaggcgcttgccaaaaaggcggcggcatga

DBGET integrated database retrieval system