KEGG   Ruminococcus gnavus: RGna_16880
Entry
RGna_16880        CDS       T06719                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
rgn  Ruminococcus gnavus
Pathway
rgn00230  Purine metabolism
rgn01100  Metabolic pathways
rgn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rgn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RGna_16880
Enzymes [BR:rgn01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     RGna_16880
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QHB24985
Position
3359180..3361477
AA seq 765 aa
MEEREHVVGKSVTRVDALEKVTGRAKYTEDLCDKSAYIARVLHADIAHGIVRSVDTSEAQ
KLPGVVKIVTCFDVPKYYFPTAGHPWSTDPAHQDVKDRLLLTEHVRFYGDDVAAVVAENE
VAAAQALRLIKVEYDPLPFVLDVQKAMEEDAPQLHENYPGNVLKHTSLHKGDFEKAKEEP
GLIKVEGWYQTPTVQHCHIENFICYAYMEQGRYVIVSSTQIPHICRRVVGQALGIPWGNV
RVIKPYIGGGFGNKQDILYEPLCAYLSQTVGGRLVKLDVSREETFVCNRVRHAIRTHLIS
YVRPNGEIAARKAECFSDQGAYASHGHSIGAKALGSFPQLYPCENFEGDVYTVFTNKPVS
GAMRGYGIPQAMFAMESHTDDIAVKLGIPPYEYRWKYLMPKGYTDGFSKNVNYYDTFREC
MEKGSVSVDYERKRREYAQQTGDIRKGIGMAAFWYNTGVWPISLETSSCRMVMNQDGSIQ
VQVGETEIGQGADTAFAQMAAETLGIPFDMVHVMTMQDTDITPFGLGAYASRQTYMAGFS
IRQTAELLKSHVLDTAVEMTRQMKENLDIIDGNIVRTTDGSVLMSLGELATEKLYSLTNC
GHLTAESTYQIKNNAYSFGCTFAEVEVDIPGCRATLTNIVNVHDCGRLINPALAEAQVHG
GMSMGIGFGLSEELKFDEKTGKPLDNNLLDYKMATFEDHPDLHGEFVENYEPTSAYGTKA
LGEPPVCSVAPAIRNAILNATGSGLNELPLNPHRLFAKFREDGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaggaaagagaacatgtggtcggcaagagtgtaacgagagtggatgctttggaaaaa
gtgaccggacgggcaaaatatacggaggatctgtgtgataaaagcgcttatattgcgcgg
gtactgcatgcggatatcgctcatggaatcgtaagatcagtggataccagtgaggcgcaa
aaacttcccggggttgtaaagatcgtgacttgctttgatgtgccgaaatattatttcccg
accgcgggacatccgtggtctacggatcctgcacatcaggatgtcaaagaccgcctgctt
ttaacggagcatgtgcggttttacggggatgatgtggcagcagttgttgcggagaatgaa
gtggcagcagctcaggcgctgcggctgatcaaggtggagtatgatccccttccgtttgtg
ctggatgtacaaaaggcaatggaagaggacgctccgcagcttcatgaaaactatccggga
aatgtattgaaacacacttcgctccacaaaggggattttgaaaaagcaaaagaagagccg
gggctgatcaaagtggagggctggtatcagacaccgaccgtgcagcattgtcatatcgag
aattttatctgttatgcgtatatggaacagggcaggtacgtgatcgtctcttctacgcag
attcctcatatctgcaggcgggttgtcgggcaggcgcttggaatcccatggggaaatgtg
cgagtgatcaagccatacataggaggcggttttggaaacaagcaggacattctatatgaa
ccattgtgtgcatatctgtcacagacagtcggcgggcggcttgtaaagctggatgtgtca
cgggaagaaacgtttgtatgtaaccgggtacgccatgctatcaggacacatctgatctct
tatgtgcgtccaaatggtgagatcgctgcaagaaaagcggagtgcttttccgatcagggg
gcgtatgcatctcatggacacagcattggagcaaaggctcttggatctttcccgcagctg
tatccgtgtgagaactttgagggagatgtgtacacggtatttaccaacaaaccggtatcc
ggagctatgcgcggctatggaattccgcaggcgatgtttgcgatggaaagccatacggat
gacattgcggtgaaacttgggattccaccgtatgaatatcgctggaaatatctgatgcca
aaaggatatacggatggattttcaaaaaatgtcaattattatgataccttcagggaatgc
atggaaaaaggcagtgtcagtgtagattatgagcgaaaacgtagagaatatgcacaacaa
accggggatatccgcaaaggaatcggaatggcggcattctggtacaataccggtgtctgg
ccgatttctctggagacatcctcctgccgtatggtcatgaatcaggacggttcgattcag
gtgcaggtaggggagacggagattggacagggcgcagatactgcatttgcgcagatggcg
gcagagacactggggattccgtttgatatggttcatgtgatgaccatgcaggatacggat
atcacaccgtttggtcttggagcctatgcgtccaggcagacctatatggctggattttcc
attcggcagacagcagagctgttaaaaagtcatgttttggatacggcagtggagatgacg
cggcagatgaaagaaaatctggatattatagatggaaacattgtgcgtacgacagacggc
agtgttctgatgtcattgggtgagctggcaacagaaaaactctacagcctgactaactgc
ggacatctcacggcagagagtacctatcagatcaaaaataatgcctactctttcggctgt
acctttgcggaagtagaggtagatattccgggatgccgggccacactgacgaatatcgtc
aatgtacatgactgcggaaggctgatcaatccggcgctggcggaagcgcaggtgcatgga
ggcatgagtatgggaattggattcggactttccgaagagctgaaatttgatgagaaaacg
ggaaaacctttggacaataatcttctggactataagatggcgacatttgaagatcatccc
gatctgcacggggagtttgtggaaaattatgagcccaccagtgcttacggaacgaaagct
ctcggagaaccgccggtatgttcggttgcgccggcaatccgcaatgcgattttaaatgca
accggatccgggctcaatgagcttccgctgaatccgcacaggctgtttgcaaaattccgg
gaagacggattgatttaa

DBGET integrated database retrieval system