KEGG   Rhizobium johnstonii: pRL70071
Entry
pRL70071          CDS       T00402                                 
Name
(GenBank) putative transmembrane conjugative DNA transfer protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
rle  Rhizobium johnstonii
Pathway
rle03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rle00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    pRL70071
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rle02044]
    pRL70071
Enzymes [BR:rle01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     pRL70071
Secretion system [BR:rle02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   pRL70071
SSDB
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind DUF1657
Other DBs
NCBI-ProteinID: CAK11600
RhizoBase: pRL70071
UniProt: Q1M9V4
Position
pRL7:56589..58643
AA seq 684 aa
MDGSTTRKLNTLLFAFLFSLTMGLLFASIYASFCRHGISRETINRFDIFSFWYETPLYVG
YATPVFLRGLTIAVSTAVITTMVGAIVILKKRNYHGTARWATRQELQRAGYIRRFRNITG
PIFGKTVGPRWPGRYLTNGEQPHSLVVAPTRAGKGVGVVIPTLLTFNGSILALDVKGELF
ELTSRARMARGDRVFKFAPLDSAGRTHSYNPVLDIVNMPPERRFSETRRLAVNLIVAKGK
GSEGFIEGARDLFIAGILACIERGTPTIGAVYDLFTQPGEKYKLFAQLAEETQNQEAQRI
FDNMAGNDTKILTSYTSVLGDGGLNLWADPLIKAATTKSDFSIYDLRRDPTSIFLCVSPN
DLEVIAPLIRLFFQQVVSILQRTLPKKDEIFEVLFLLDEFKHLGKLEAIETAVTTIAGYK
GRFMFIIQSLSALTGAYEESGKENFLSNTGIQIFMATADDETPNYISKAIGDYTFRARST
SFSQRNIFDTNIQLSDQGAPLLRSEQVRLIDDDMEIVLIKGQPPLRLKKVKYYSDRVLKR
IFDNQSGALPEPEPLHLATTYVQAPATLLVAAESLPDEAKSEDALQAALPDFAEVPVKDH
AFSDFPAGGAASSDAGGKYADVEYAHDVYGPDRVSDDHLSEEELQALAAQRALLDRIIDL
QRRSNAWQTGELAPGAMHSDDHGS
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggacgggagcacgactcggaaattgaacacgctactgtttgccttccttttttcgctg
acgatggggcttttgttcgcgagtatttatgcaagcttctgtcggcacggcatcagccgc
gaaactatcaatcgcttcgacatcttctccttctggtacgaaacgcccctctatgttggc
tacgccacaccggtgttcctccgtggcttgaccatcgccgtcagtactgccgtaatcact
acaatggtgggcgccattgtgattttaaaaaagcggaattatcatggcacagcgcgctgg
gccacgcggcaggaactacagcgagcgggctatatcaggcgttttcgcaacataaccgga
ccgatctttggcaaaacggttgggccgcgttggccgggtcgatatctaactaacggcgaa
caaccgcatagtctcgtcgtggccccgacgcgcgccggcaagggcgttggcgtggtcatc
ccgacgcttctgaccttcaacggttcgattctggcgctcgacgtgaagggggagctattc
gagctcacttcgcgcgcccgcatggcgcggggcgatcgggttttcaagttcgcgccactc
gacagtgcgggacggacccacagttacaaccctgtgcttgacatcgtcaacatgccgccg
gagcgccgtttcagcgagacgcggcggctggccgttaacttgatcgttgcaaaggggaag
ggatcggaaggctttattgagggcgcccgagacctttttatcgccggcatactcgcctgc
atcgaacgcggtacgccgacgatcggtgccgtctacgacctattcacccagcccggtgag
aaatacaagcttttcgcccagctagctgaggaaacgcaaaatcaagaggcacagcgaatc
ttcgataacatggccggtaatgatacaaagatcctgacttcctacacctctgtccttggt
gacggcggcctgaatctctgggcggaccccttaatcaaggcagctacaacgaagtcggat
ttttcaatttatgatctccgccgcgatcccacgtcaatttttctctgcgttagtccaaac
gatcttgaggtaatcgcccccctcattcggctgttcttccagcaggtagtctccattcta
cagcggacactgccgaagaaggacgaaatcttcgaggtgctgttcttgctggatgagttt
aagcatctcggcaaactcgaagccatagaaaccgcggtaactacgattgctggctacaag
gggcgcttcatgttcatcatccagagcctctcggctttgactggggcatatgaagagtct
ggtaaggagaatttcctaagcaatactggcatacagatctttatggccactgccgacgac
gagactccaaactatatttcgaaagccatcggcgactatacgtttcgcgcccgctccacc
tccttcagccagcgcaacattttcgataccaatattcagctttccgaccagggcgcgccg
ctgttgcggtccgagcaagtgcgcctcatcgacgacgacatggagatcgtgctgatcaaa
gggcaaccgccgctccggctaaaaaaggtgaaatattattccgaccgcgtgctgaagcgg
attttcgataaccagtctggcgccttgccggagccagaacccctccaccttgcgaccact
tacgtacaagcgcccgcgacgctgctcgttgccgcggaatcgctaccggatgaagcgaaa
tcggaggacgccttgcaggccgcgttgcccgattttgccgaggtcccggtgaaagaccac
gcattcagcgactttccggcggggggcgcggccagttcggatgcgggcggaaaatacgct
gatgtcgaatatgcgcacgacgtctacggaccggaccgggtcagcgacgatcacctgagc
gaggaggaactacaggctcttgccgcccagcgggcacttcttgaccggatcatcgatctg
cagaggcggtcgaatgcttggcaaacaggtgaactggcgccaggagccatgcactcggat
gaccacggttcttga

DBGET integrated database retrieval system