KEGG   Cupriavidus metallidurans: Rmet_0391
Entry
Rmet_0391         CDS       T00351                                 

Gene name
atmA
Definition
(GenBank) ABC-type transporter, ATPase and permease components: HMT family
  KO
K24821  ATP-binding cassette, subfamily B, heavy metal transporter
Organism
rme  Cupriavidus metallidurans
Pathway
rme02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rmet_0391 (atmA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rme02000]
    Rmet_0391 (atmA)
Transporters [BR:rme02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    Rmet_0391 (atmA)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 AAA_29 RsgA_GTPase AAA MMR_HSR1 ABC_ATPase AAA_24 Zeta_toxin AAA_33 DUF87 Septin AAA_15
Other DBs
NCBI-ProteinID: ABF07277
UniProt: Q1LRE9
Position
418454..420346
AA seq 630 aa
MRRYSTTAEPAPAEPANSLFQGGGARRSDWQTVRNLLPYVWHYKWRVMLALTCLVAAKVA
NLGVPVLMKKLVDSMNIAPGDPAALLAVPVGLIVGYGLLRLSSTLFTELREILFSKVTQS
AVREIALQVFRHLHALSLRFHLDRQTGGMSRDIERGTRGIQSLISYSLYSILPTLVEMSL
VIGFFVVRYDIWFAAITICALAGYIVFTIVVTEWRTHFRRKMNELDSRANQKAIDSLLNF
ETVKYFGNEEYEARRYDENLRTYRTAAIRSQNSLSFLNFGQQAIIALGLILILWRATVGV
AAGKLTLGDLVLVNTLMIQLYIPLNFLGVIYREIKQATTDMDRMFVLLGTQQEVADTPGA
PVLAVNGAEVRFRHVGFGYEKNRVILDDVDFTIAAGTTTAVVGHSGSGKSTLARLLFRFY
DVTRGSIEVDGQDIRKVRQVSLRASIGIVPQDTVLFNDSIYYNIAYGRPEATREEVIEAA
RAAQIDTFISELPQGYDTPVGERGLKLSGGEKQRVAIARTLLKNPPILVFDEATSALDSR
TEQAIQSELMRLAQNRTTLLIAHRLSTVVHADQILVMDRGRIIERGTHAELMRANGHYAE
MWQIQARNAAEGSPDADALAIDVGDATQDA
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgccgctattccacgaccgccgagcccgcccccgccgagccggcaaattcgctgttc
cagggcggcggcgcgcgccgcagtgactggcagaccgttcgcaacctgctcccctacgtc
tggcactacaagtggcgcgtgatgctggcgcttacctgcctggtcgccgccaaggtggcc
aacctgggcgtgccggtgctgatgaagaagctggtcgacagcatgaacatcgcgcctggc
gatccggcggcgttgctggccgtgccagtgggattgattgttggctacggcctgttgcgc
ctatcgagcacgctgttcaccgagttgcgtgaaatcctcttctcgaaggtcacgcagagc
gcggtgcgagagatcgcgctgcaggtgttccgccatttgcacgcgctgtcgctgcgcttc
catctggatcggcagaccggggggatgagccgggacatcgagcgcgggacgcgcggcatc
cagtcactgatctcgtactcgttgtacagcatcctgcccacgctggtcgagatgtcgcta
gtgatcggcttcttcgttgtgcgctacgacatctggttcgccgcgatcacgatctgcgcg
ctggctggctacatcgtgttcacgatcgtcgtgaccgaatggcgcacgcatttccggcgc
aagatgaacgagctcgactcgcgcgccaaccagaaggcaatcgactcgctgctgaacttc
gagaccgtgaaatatttcgggaacgaggagtacgaggcacgccgctacgacgagaacctg
cgtacctatcgcacggcggcgatccgctcgcagaactcgctgtcgttcctgaatttcggc
cagcaggcgatcatcgccctgggcctgatcctgatcctgtggcgtgccacggtgggcgtt
gccgccggcaagctcacgcttggtgacctcgtgctggtcaacacgctgatgatccagctc
tatatcccgctcaacttcctgggcgtgatctatcgcgagatcaagcaggccaccaccgat
atggaccgcatgttcgtgctgctcggcacgcaacaggaggtggccgacacgcccggcgcg
ccggtgctcgccgtcaacggcgccgaggtgcgcttccgccatgtcggctttggctacgag
aagaaccgcgtgattctcgacgacgtcgatttcacgatcgcggcggggacgacaacggcc
gtggttggccacagcggctcgggcaagtccacgctcgcgcggctgctgttccgcttctac
gacgtcacgcggggcagcatcgaggtcgatgggcaggacatccgcaaggtgcggcaggtc
agcctgcgcgcgtcgatcggcatcgtgccgcaggacaccgtgctgtttaacgacagcatc
tactacaacatcgcctatggccgcccggaggccacgcgcgaggaagtcatcgaggcagcg
cgcgccgcgcagatcgacacctttatcagcgaattgccgcagggctacgacacgccggtg
ggcgagcggggcctgaagctgtccggcggcgagaagcaacgggtggccatcgcgcgcacg
ctgctgaagaacccaccgatcctggtattcgacgaagccacgtcggcgctcgactctcgc
accgaacaggcgatccagtcggaactgatgcggctggcgcagaatcgcaccacgctgctg
atcgcgcaccggctatcgaccgtggtgcacgccgaccagattcttgtgatggaccgtgga
cgcatcatcgagcgcggcacccatgccgagctgatgcgggccaatggccactacgccgag
atgtggcagatccaggcgcgcaacgcggcggagggctcgcccgatgccgacgcgctggcg
atcgatgtgggcgacgccacgcaggatgcatag

DBGET integrated database retrieval system