KEGG   Ralstonia mannitolilytica: TK49_07980
Entry
TK49_07980        CDS       T03778                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
rmn  Ralstonia mannitolilytica
Pathway
rmn00626  Naphthalene degradation
rmn01100  Metabolic pathways
rmn01120  Microbial metabolism in diverse environments
rmn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rmn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    TK49_07980
Enzymes [BR:rmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     TK49_07980
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AJW44651
Position
1:1671489..1672526
AA seq 345 aa
MTRKTSKAVRLTAADIQGVWVIMPTPSTPDASDWRSTHTVDLDETARIVEELIAAGVNGI
LSHGTFGECATLTWEEKRDFVSTVVETARGRVPYFCGTTALNTREVIRQTRELIDIGAQG
TMLGVPMWVKMDLPTAVQFYRDVAEAVPDAAIAVYANPEAFKFDFPRPFWAEMSKIPQVV
TAKYLGIGMLDLDLKLAPNIRFLPHEDDYYAAARINPERITAFWSSGSMCGPATALVLRD
EVVKAKKTGDWAKAKAISDDMRAADATLFPRGDFSEFSKYNIGLEKARMDAAGWLKAGPC
RPPYTLVPDEYLAGARKSGKAWAALHTKYAKELRKTKTATNSKKK
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgacaagaaagacgagcaaagcggtgcgcctgaccgccgcggatattcaaggcgtatgg
gtcatcatgccgaccccgtccacgccggatgcctcggactggcgcagcacgcacacggtc
gatctcgacgagacggcccggattgtcgaggagttgattgcggccggcgtcaatggcatt
ctgagccacggcacctttggcgaatgcgcgacgctgacgtgggaggagaagcgggatttt
gtttcaacggtcgtggaaaccgcgcgcggtcgagtgccctacttctgcggcacaacggcc
ttgaatacccgtgaagtcatacgccagacccgcgaattgatcgacattggcgcccaagga
acaatgctcggcgtgccgatgtgggtgaagatggatctgcctactgccgtgcaattttat
cgcgatgtggcggaagcagtgccagatgcagccatcgctgtctacgccaacccggaggct
ttcaaatttgattttcctcgcccgttttgggccgaaatgtccaaaatcccgcaggttgtc
acagccaagtacttgggcatcgggatgctggacttggatctgaaattggccccaaatatt
cgcttccttccgcatgaggatgactactacgctgcggcccggatcaatcccgagcgcata
actgctttctggtctagcggttccatgtgcggcccagcgaccgcccttgtgctgcgcgat
gaggtggtaaaggccaaaaagaccggtgattgggccaaggccaaggctatttcagatgac
atgcgcgcagccgatgccacactgtttccacgcggcgatttctcggaattctcaaaatac
aacattggcctcgaaaaagcacgaatggacgcggccggctggctcaaggcggggccgtgc
cggccaccctatacgctggttcccgacgaataccttgcaggtgcccgaaaatcaggcaag
gcctgggccgcactgcataccaagtatgccaaggaattgaggaaaaccaaaacggcaacc
aactcgaaaaagaagtaa

DBGET integrated database retrieval system