KEGG   Rattus norvegicus (rat): 100301568
Entry
100301568         CDS       T01003                                 

Gene name
Abo, Abo2
Definition
(RefSeq) ABO, alpha 1-3-N-acetylgalactosaminyltransferase and alpha 1-3-galactosyltransferase
  KO
K00709  histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100301568 (Abo)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    100301568 (Abo)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     100301568 (Abo)
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     100301568 (Abo)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  ABO blood group
   100301568 (Abo)
SSDB
Motif
Pfam: Glyco_transf_6
Other DBs
NCBI-GeneID: 100301568
NCBI-ProteinID: NP_001153735
RGD: 2307241
Ensembl: ENSRNOG00000046958
UniProt: Q8CFC4
Position
3p13
AA seq 334 aa
MKDLRFGRLKCYSLHLGILPLTVLVLVFFCFVCLSLRSQEWGHPGAVNRKAYPQPRVLTP
TRTDVLVLTPWLAPIIWEGTFDIDTLNEQFRLRNTTIGLTVFAVKKYVVFLKLFLETAEQ
HFMVGHKVIYYVFTDRPADVPQVPLGAGRRLVVLTVRNYTRWQDVSMHRMEVISHFSEQR
FRHEVDYLVCADVDMKFRDHVGVEILSALFGTLHPGFYRSRRESFTYERRPQSQAYIPWD
QGDFYYMGAFFGGSVVEVHHLTKACHQAMVEDQANGIEAVWHDESHLNKYLLYHKPTKVL
SPEYMWDQQLLGWPSIMKKLRYVAVPKNHQAIRN
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgaaggatctgcggttcggaagactgaaatgctactcccttcatcttggaatccttccc
ctcacggtgctcgtcttagtcttcttttgcttcgtgtgcctgagcctcagaagccaggaa
tgggggcacccaggagctgtgaataggaaggcctatccccagccaagggtactgacaccc
actaggacagatgttcttgtcctgactccttggctggctcccatcatctgggaggggacc
ttcgacattgacacactgaatgagcagttcaggcttcggaacaccacgatcggactgact
gtgtttgccgtcaaaaagtatgtggtgttcctgaagctcttcctggagacggcagagcag
cacttcatggtgggacacaaggtcatctactatgtcttcactgaccggccagctgatgtc
ccacaggtgcccctgggtgcaggacggcggctggtggtgctaactgtgcgcaactacacc
cgctggcaggacgtgtccatgcacaggatggaggtgatcagccacttctcagagcagcgc
tttcggcatgaggtggactacctggtgtgtgcagatgtggacatgaagttcagggaccac
gtgggtgtggagattctctcagcgctctttggcaccctgcatcctggcttctaccgtagc
cgacgagagtcctttacctatgagcgccggccacagtcccaggcctacatcccctgggac
cagggtgacttttactatatgggagccttctttggggggtcagtggtggaggtgcaccat
ctcaccaaggcctgccaccaggctatggtggaggaccaggccaatggcattgaggccgtg
tggcatgacgagagccatctgaacaagtacctgctataccataagccgacaaaggtgctg
tccccagagtacatgtgggaccagcagctactgggctggccctccatcatgaagaagctg
agatatgtggccgtgcccaagaaccatcaggcgatcaggaactga

DBGET integrated database retrieval system