KEGG   Rattus norvegicus (rat): 100362710Help
Entry
100362710         CDS       T01003                                 

Gene name
Tiam2
Definition
(RefSeq) T-cell lymphoma invasion and metastasis 2
  KO
K16847  T-lymphoma invasion and metastasis-inducing protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    100362710 (Tiam2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tiam_CC_Ex RhoGEF PH PH_9 PDZ PDZ_6 RBD PH_11 PH_13
Motif
Other DBs
NCBI-GeneID: 100362710
NCBI-ProteinID: XP_006222963
RGD: 2324148
Ensembl: ENSRNOG00000016728
UniProt: D3ZMS5
Position
1q11
AA seq 1714 aa AA seqDB search
MGNSESQYTFQGSKNQSNTVTGAKQKPCSLKIRSIHAKDEKSLHGWAHGSGGAGYKSRSL
ARSCLSHFKSHQPYATRLNGPTCKVSKGTAYSKHRANAPGNDFQGNNGAFLPENGFHYVG
RESGESHITSRDCNGHLLTCYGRHDSIASTPPGEDRRSPRVLIKTLGKLDGCLRVEFHNG
GNPHKGPSEDPSEPVQLLRYSPTLAAETCPVPESRRLSGAGSSASQRPSPTDSCLRSSKG
SSLSSESSWYDSPWGNAGEASEVDGTFLAPSALDPSLPSSFPPSDTKKPFNQSSSLSSLR
ELYKDANLGCRSPSGTCLSSNEYISSQVGLNNRVSFASDMDVPSRVDHRDTMQYSSFTLP
CRKSKALTEDAAKKDTLKARMRRFSDWTGSLSRKKRKLQEPRSTEGSEYFDSHSDGLNAD
VQGPTQTSALLWSGGSAQTLPHRSESTHAIGSDPLQQNIYENFMRELEMSRTNMENAETS
TETVESSSESLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTLQKERKLELVARRKWKQYW
VTLKGCTLMFYETYGKNSTDQNSAPRCALFAEDSIVQSVPEHPKKEHVFCLSNSYGDVYL
FQATSQTDLENWITAIHSACASLFAKKHGKEDTVRLLKSQTRGLLQKIDMDSKMKKMAEL
QLSVVSDPKNRKAIENQIRQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAATSRP
SKLALGRLGVLSVSSFHALVCSRDDSALRKRTLSFTQRAKSKKGLFSSLKGLDTLARKGR
EKRASITQMFDSSHSHGYLGTQLPQNSTNSSEVHDLHLYGSSADSTLRDSTWEVQTYVHF
QDNEGVTVIIKPEHRVEDVLALACKMRHLEPTRYGLQLRKVVDESVEWCVPALYEYMQEQ
VYDEIEVFPLSVYDVQLTKTGDMTDFGFAVTAQVDEHQHLSRIFISDVLPDSLAYGGGLR
KGNEIRSLNGEAVSDLDLKQMEALFSEKSVGLTLVARPADTRASLCTSCSDSDLFSRDQK
SLLPSPNQCQLLEEFLDNFKKTSTNDFSNVPDVTTGLKRSHTEGTLDQVPHREKMEQTFR
SAEQIVELCRGTTSMEAPTDSRDPPPRPLARHLSDADRLRKVIQELVDTEKSYVKDLSCL
FELYLEPLQNETFLTQDEMESLFGSLPEMLEFQKVFLETLEDGISASSDFSVLETPSQFR
KLLFSLGGSFLYYADHFKLYSGFCANHIKVQKVLERAKTDRAFKAFLDARNPTKQHSSTL
ESYLIKPVQRVLKYPLLLKELVSLTDHESEEHYHLTEALKAMEKVASHINEMQKIYEDYG
TVFDQLVAEQSGTEKEVTELSMGELLMHSTVSWLNPFLSLGKARKDIELTVFVFKRAVIL
VYKENCKLKKKLPSNSRPAHNSADLDPFKFRWLIPISALQVRLGNTAGTENNSTWELIHT
KSEIEGRPETIFQLCCSDSESKTSIVKVIRSILRENFRRHIKCELPMEKTCKDRLVPLKN
RVPVSAKLASSRSLKVLRTSSSSEWPSDPSKGNSLDSDECSLSSGTQSSGCPVAESRQDC
KSTVLEKDAHEVLAEFPDGLIKESDILSDEEEDFHHPLKQGSPTKDIELQFQRLRISEEP
DMHSTGQQPPLTGPGEQPKLVRGHFCPIKRKANSTKRGRGTLLKAQTRHQSLDSHPETAS
IDLNLVLEREFSVQSLTSVVNEECFYETQSHGKS
NT seq 5145 nt NT seq  +upstreamnt  +downstreamnt
atggggaactccgagagtcaatataccttccaaggatccaagaatcaaagcaatactgtc
actggtgctaagcagaagccgtgctctctgaagatacgcagcattcatgcaaaagatgag
aagtccttgcatggttgggctcacgggagcggcggagcaggctacaagtccagatcccta
gccaggagctgcctttctcactttaagagtcaccagccttacgccaccagactcaatgga
cccacgtgtaaagtctcaaagggcactgcctactctaagcacagagcaaatgccccagga
aatgattttcagggcaacaatggtgctttcttacccgagaatggcttccactatgttggg
cgcgagtcaggggagagccacatcacctccagggactgcaatggacaccttctcacctgc
tatgggagacacgacagcattgcctccactcctccaggtgaggaccgcaggagccccagg
gtgctcatcaagacactggggaagctagatgggtgtttaagagttgagttccacaatggc
ggcaacccccacaaagggccctcagaggaccccagtgaacctgtacagctgctaagatac
tcccctacgttagcagcggaaacctgcccggtgccggaaagtaggcggctttcgggtgca
ggctcctcagccagccagcgcccttctcccactgactcttgcctgcgctccagtaaaggc
agctccctgagctcggagtcctcctggtatgactccccctggggcaacgcaggggaggcg
agtgaagtggacggcaccttcctggctcccagtgctctagaccccagcctccccagcagc
ttcccacccagtgacaccaaaaagcctttcaaccaaagctcttccctctcctctctccgg
gaactgtacaaagatgccaacctggggtgccgctcaccttccggcacctgcctttcttcc
aacgagtacattagctcccaagtcggcctgaacaaccgagtctcctttgcttctgacatg
gatgtgccctccagggtggatcacagggacaccatgcagtacagctcctttactctcccg
tgtcgcaagtccaaagccttaactgaggatgcagctaagaaagacaccctcaaagccaga
atgcggcgcttcagtgactggacaggaagcctttccaggaagaagaggaaattgcaggaa
cccagatccacggagggcagtgagtacttcgatagccactcggatggactgaatgcagat
gtgcaggggcccacgcagacatctgccttactgtggtcagggggctcagctcagaccctg
cctcacagaagcgaatccactcacgcaatcggcagcgatcccctccaacagaacatctac
gagaatttcatgcgagagctggaaatgagcaggaccaacatggagaacgcggaaacgtcc
acagagactgtggagtccagcagcgagtccctcagctcgctggagcagctggatctgctc
tttgagaaggagcagggggtggtccgaaaagctgggtggctcttcttcaaaccccttgtc
accttgcagaaggagaggaaactggagctggtggctcggaggaagtggaaacagtactgg
gtgaccctgaaaggctgtactctgatgttttatgagacctacggaaagaattccacagac
cagaatagcgccccacggtgtgccctctttgcagaggacagcattgtgcagtctgtccca
gagcatcccaagaaggagcacgtgttctgcctgagtaactcctatggagatgtctacctt
ttccaggccactagccagacggatctggaaaactggatcactgccatacactcggcgtgc
gcatccctctttgcaaagaagcatgggaaagaagacacggtgcggctgctgaagagccag
accagaggcctgcttcagaagatagacatggacagcaagatgaagaagatggcagagctg
cagctgtctgtggtgagcgaccccaagaacaggaaggccatcgaaaaccagatccggcaa
tgggagcagaacctggaaaaattccacatggacctgttccgcatgcgctgctatttggca
agcttacaaggtggggagttaccaaaccccaagagtctccttgcagccaccagccgcccc
tccaagctggctcttggcagactgggcgtcctgtctgtttcatctttccatgctctggta
tgttccagagacgattctgctctcaggaaaagaacactttcctttacccagagagcaaaa
agcaagaaaggcctattttcttcattgaaaggtctggacactctagcaagaaaagggagg
gagaagagagcttctataactcagatgtttgattcgagccacagccatggatatcttgga
actcaactacctcaaaactccactaactccagtgaggtccatgacctgcatctgtatggc
tcctcagcagacagcactctccgagacagcacgtgggaagtacagacttatgtccacttc
caggataacgaaggagtcactgtgatcatcaagccagagcacagggtggaagatgttctg
gctttggcatgcaagatgaggcacttggaacccactcgctatggtcttcagctccgaaag
gtggtggatgaaagtgtggagtggtgtgtgcccgcgttgtatgagtacatgcaggagcag
gtttatgatgaaattgaagtcttcccactcagtgtgtatgacgtgcagctaaccaagacg
ggggacatgactgactttgggtttgcagtcacagcccaggtggacgagcaccagcatctc
agccggatatttatcagcgatgttctccctgacagcctggcgtatggaggaggactgaga
aagggcaatgaaatcaggagcttaaatggggaagcagtgtctgaccttgacctcaagcag
atggaggctttgttttctgagaagagcgttggactcactctagtcgcccggcctgcagac
acaagagcaagcctgtgtacttcctgctcagacagtgacctgttctccagggaccagaaa
agtctgctgccctctcccaaccagtgccaactgctggaggaattcctggataactttaaa
aaaacctccacaaacgatttcagcaatgtccctgacgtcacaactggcctgaagaggagc
catacagaaggcaccctggatcaggtgccccacagggagaagatggagcagacattccgg
agtgctgagcagattgtggagctctgcagaggcaccaccagtatggaagcaccgacagac
agccgcgacccgcctcccaggcctctggctcgtcacctctcagatgcagaccgcctccga
aaagtcatccaggagcttgtagacaccgagaagtcttacgtgaaggatctgagctgcctc
tttgaactgtacttggagccccttcagaacgagacctttcttacccaagatgagatggag
tcactttttgggagcttgccagagatgctggaatttcaaaaggtgttcctggagactctg
gaggatgggatctctgcttcctcagactttagtgtcctggaaaccccctcacagtttcgg
aaattgctgttctctctcggaggctctttcctctactacgcagatcactttaaactgtac
agtggattctgcgccaaccacattaaagtacagaaggtcctagagcgagctaaaaccgac
agagctttcaaggcttttctggacgcgcggaaccccacgaagcagcactcctccacgctg
gagtcatatctcatcaagcctgttcagagagtgctcaagtatcctctgctcctcaaggag
ctcgtgtcactgactgaccatgagagcgaagaacactatcacctgacagaagctctaaag
gccatggaaaaagtagccagtcacatcaatgagatgcagaagatctacgaggactatggg
acggtgtttgaccagctggtggcagagcagagtggcacagagaaggaggtaacagagctg
tccatgggggaacttctgatgcactctacagtttcctggttgaatccgttcctgtctctg
ggaaaagccaggaaggacattgagctcacagtgtttgtttttaagagagctgtcatactg
gtttataaagaaaactgcaagctgaaaaagaaactgccctccaattcccggcctgctcac
aactctgctgacttggacccatttaaattccgctggttgatccccatatctgcgcttcaa
gttagactggggaacacggcagggactgaaaacaattccacctgggagctgattcatacc
aagtcagaaattgaaggacggccagagaccatctttcaactgtgctgcagtgacagcgag
agcaaaaccagcatcgttaaggtgatccgttctattctgagagagaacttcaggcgccac
ataaagtgtgagttaccaatggagaagacatgtaaggaccggctggtacctcttaagaac
cgagttcctgtttcagccaaattagcctcatccaggtctttgaaggtcctcagaacatcc
tccagcagcgagtggcccagcgaccccagcaagggcaactcactggactcggatgagtgc
agcctgagcagtggcacccagagcagtggctgcccagtagctgagagcagacaagactgt
aagagcaccgtgctggagaaagacgctcatgaggtcctggcagagtttccagatggtctc
atcaaagaaagcgacattctaagtgatgaagaggaggacttccaccaccctctgaaacag
ggcagccctactaaggacattgagcttcagttccagagactgcgaatctctgaggaaccc
gatatgcactcaactgggcagcagccgcctctcacagggccgggtgaacagcccaagctg
gtcaggggccacttttgccccattaagcgtaaagcaaacagcactaagaggggccgagga
actttgctcaaggcgcagacacgtcaccagtccctggacagccacccggaaaccgccagc
atcgatctaaatttggttctggagagagaattcagtgtccagagcttaacttcagttgtt
aatgaggagtgtttttatgaaacacagagccatggcaaatcctag

DBGET integrated database retrieval system