KEGG   Rattus norvegicus (rat): 100362805
Entry
100362805         CDS       T01003                                 

Gene name
Txndc5
Definition
(RefSeq) thioredoxin domain containing 5
  KO
K13984  thioredoxin domain-containing protein 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100362805 (Txndc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    100362805 (Txndc5)
   04131 Membrane trafficking [BR:rno04131]
    100362805 (Txndc5)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100362805 (Txndc5)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100362805 (Txndc5)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2 OST3_OST6 Thioredoxin_8 HyaE Thioredoxin_7
Other DBs
NCBI-GeneID: 100362805
NCBI-ProteinID: NP_001258259
RGD: 2323973
Ensembl: ENSRNOG00000013469
UniProt: D3ZZC1
Position
17p12
AA seq 417 aa
MPPRPGRLFQPLAGLPALATLLLLLGARKGARAQEVEADSGVEQDPHAKHLYTADMFTHG
IQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTANSDVCSAQGVR
GYPTLKFFKPGQEAVKYQGPRDFETLENWMLQTLNEEPATPEPEAEPPRAPELKQGLYEL
SANNFELHVSQGNHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVC
SEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVLAA
EPPGDKGTVLALTEKSFEDTIAQGITFVKFYAPWCGHCKNLAPTWEELSKKEFPGLADVT
IAEVDCTAERGVCSKYSVRGYPTLLLFRGGEKVGEHNGGRDLDSLHSFVLRQAKDEL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgcccccgcgcccaggacgcctcttccagccgctggccgggctaccggctctggccacg
ctcctgctgctgctcggagcgcgtaagggtgcccgggcccaggaggtggaggcggacagc
ggggtcgagcaggacccgcacgccaagcacctgtatacggccgacatgttcacgcacggg
atccagagcgccgcgcacttcgtcatgttcttcgcgccctggtgtggacactgccagcgg
ctgcagccaacctggaatgacctgggagacaagtataacagcatggaagacgccaaggtc
tacgtggccaaggtggactgcacggccaactctgacgtgtgctctgcccagggagttcga
ggatatcccacccttaagttttttaagcctggacaagaagcagtgaagtaccagggtcct
agagactttgaaacactggaaaactggatgctgcagaccctgaacgaggagccagctaca
ccagagccagaggcagaaccacccagagctcccgagcttaagcagggcttgtatgagctc
tcggccaacaactttgagctgcatgtttctcaaggcaaccactttatcaagttcttcgct
ccatggtgtggtcactgcaaagctctggctccaacttgggagcagctggctctgggcctc
gaacattctgaaactgtcaagattggcaaggttgactgcacgcagcactacgcggtctgc
tcagagcaccaggtcagaggctacccaactctgctctggtttcgagatggcaagaaggtg
gatcagtacaagggaaagagggacttggagtcgctgagagactatgtgcagtcccagctg
cagggttcggaggcggctccggagactgttgagccatcagaggccccggtgctggctgct
gagcctccgggcgacaagggcactgtgctggcactcactgagaagagctttgaggacact
attgcacaaggaataaccttcgtcaagttctatgctccctggtgtggccactgcaagaat
ctggctcctacctgggaagagctctctaagaaggaattccctggcttggcagacgtcacc
atcgcagaagtggactgcaccgctgagcgtggtgtttgcagcaagtactcggtacgaggc
taccccacattgctgcttttccggggaggtgagaaagtgggtgagcacaatggaggcaga
gacctcgactctctacacagctttgttctgcgccaggcaaaggatgaactctaa

DBGET integrated database retrieval system