KEGG   Rattus norvegicus (rat): 100909657
Entry
100909657         CDS       T01003                                 

Definition
(RefSeq) uncharacterized LOC100909657
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf_UBZ C1_4 XPA_N Zn-ribbon_8 DUF5830 zinc_ribbon_15 DNA_RNApol_7kD HypA zf-C2H2_11 DUF3268
Other DBs
NCBI-GeneID: 100909657
NCBI-ProteinID: XP_008761490
RGD: 6502210
Ensembl: ENSRNOG00000014552
UniProt: M0RBC3
Position
4q42
AA seq 201 aa
MDEKPYKCDKCGKGFTRSSSLLVHHSVHTGEKPFKCDRCGKGFSQSSKLHIHQRVHTGEK
PYECEECGMSFSQRSNLHIHQRVHTGERPYKCGECGKGFSQSSNLHIHRCTHTGEKPYQC
YECGKGFSQSSDLRIHLRVHTGEKPYHCGKCGKGFSQSSKLLIHQRVHTGEKPYECSRCG
KGFSQSSNLHIHQRVHRKDLH
NT seq 606 nt   +upstreamnt  +downstreamnt
atggatgagaaaccgtacaaatgtgacaagtgcgggaagggcttcaccaggagctcaagt
ctgcttgtccatcattcagtccatacaggtgagaaacctttcaagtgtgacaggtgtggg
aagggcttcagtcagagctcaaagctgcacatccaccagagagtccacactggagagaag
ccgtatgagtgtgaggagtgtggtatgagcttcagtcagcgatcaaacctgcacatccac
caacgtgtccacacaggagagaggccctacaagtgcggggagtgtggaaaaggcttcagc
cagagctcgaacctacacatccaccggtgcacccacacaggagagaagccgtaccagtgc
tacgaatgcgggaaaggcttcagccagagctcagaccttcgaatccacctcagagtgcac
actggggaaaagccctaccactgtggcaagtgcgggaagggcttcagccagagctccaaa
ctcctcatccatcagagagtccacacgggagagaagccgtatgaatgcagcaggtgtggg
aagggcttcagccagagctcaaacctccacatccaccagcgggttcacaggaaggacctt
cactaa

DBGET integrated database retrieval system