KEGG   Rattus norvegicus (rat): 102550385
Entry
102550385         CDS       T01003                                 

Definition
(RefSeq) LYR motif-containing protein 4-like
  KO
K22069  LYR motif-containing protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    102550385
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    102550385
SSDB
Motif
Pfam: Complex1_LYR Complex1_LYR_2 Complex1_LYR_1 PPTA DUF4049
Other DBs
NCBI-GeneID: 102550385
NCBI-ProteinID: XP_006222439
RGD: 7672286
Ensembl: ENSRNOG00000047970
UniProt: D3ZYM7
Position
17p12
AA seq 91 aa
MAASSRAQVLDLYRAMMRESKHFSAYNYRMYAVRRIRDAFRENKNVKDPVEIQALVNKAK
RDLEIIRRQVLIGQLYSTDKLIIENQENPRT
NT seq 276 nt   +upstreamnt  +downstreamnt
atggcagcctccagccgcgcacaagttttagatctgtaccgggcgatgatgagagagagc
aagcatttcagcgcctacaattacagaatgtatgctgtcaggagaataagagatgccttc
cgagaaaataagaatgtaaaagaccccgtagaaattcaagccctggtgaataaagccaaa
agagaccttgaaataatccgcagacaggtccttattggccaactgtactcaactgacaag
cttatcattgagaatcaggagaatccaaggacatag

DBGET integrated database retrieval system