KEGG   Rattus norvegicus (rat): 114106Help
Entry
114106            CDS       T01003                                 

Gene name
Bco1, Bcdo, Bcmo1
Definition
(RefSeq) beta-carotene oxygenase 1
  KO
K00515  beta-carotene 15,15'-dioxygenase [EC:1.13.11.63]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00830  Retinol metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    114106 (Bco1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.63  beta-carotene 15,15'-dioxygenase
     114106 (Bco1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 114106
NCBI-ProteinID: NP_446100
RGD: 70981
Ensembl: ENSRNOG00000012027
UniProt: G3V7N1
Position
19q12
AA seq 566 aa AA seqDB search
MEIIFGRNKKEQLEPLRATVTGSIPAWLQGTLLRNGPGMHTVGDSKYNHWFDGLALLHSF
SIRDGEVFYRSKYLQSDTYNANIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATTETNYIRKIDPQTLETLEKVDYRKYVAVNLATSHPHYDEAGN
VLNMGTSIADKGRTKYVMFKIPATAPGSKKKGKNPLKHSEVFCSIPSRSLLSPSYYHSFG
VTENYVVFLEQPFKLDILKMATAYMRGVSWASCMTFCKEDKTYIHIIDQKTRKPVPTKFY
TDPMVVFHHVNAYEEDGCVLFDVIAYEDNSLYQLFYLANLNKDFEEKSRLTSVPTLRRFA
VPLHVDKDAEVGSNLVKVSSTTATALKEKDDHVYCQPEVLYEGLELPRINYAHNGKPYRY
IFAAEVQWSPVPTKILKYDVLTKSSLKWSEESCWPAEPLFVPTPGAKDEDDGVILSAIIS
TDPQKLPFLLILDAKSFTELARASVDVDMHLDLHGLFIPDAGWNAVKQTPAKTQEDENSD
HPTGLTAPGLGHGENDFTAGHGGKSL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggagataatatttggccggaataagaaagaacagctggagccattacgggccacagtg
acaggcagcattccagcatggctgcaggggaccctgctccgaaacgggcctgggatgcac
acagtgggagacagcaagtacaaccattggtttgatggcctggcccttctccacagtttc
tccatcagagatggggaggtcttctacaggagcaaatacctgcagagcgacacctacaac
gccaacatcgaggccaatagaatcgtggtgtctgagttcggaacaatggcctacccagac
ccctgcaaaaacatcttttccaaagctttctcctacttgtcccacaccatccccgacttc
acagacaactgcctgattaacatcatgaaatgtggagaagacttctatgccaccacagag
accaactacatcaggaaaatcgacccccagactctagagaccttggagaaggttgattac
cggaagtatgtggctgtaaacctggctacctcacaccctcattacgacgaggctggaaat
gtccttaacatgggtacctccatcgcggacaaaggaaggacaaaatacgtgatgtttaag
atccccgccacagcaccaggcagcaagaagaaagggaagaaccccttgaagcactcagaa
gttttctgctccatcccgtcccgctcgctgctctcccccagttactaccacagctttgga
gtcacggagaactatgtggtgtttctggagcagccttttaagctggatatcctcaagatg
gccaccgcatacatgaggggtgtgagctgggcttcctgtatgacattctgcaaggaggac
aagacttacattcatatcatcgaccagaagaccagaaagcctgtgccaaccaaattctac
acagaccccatggtggtcttccaccatgttaatgcctatgaggaggacggctgtgtgctg
tttgatgtcatcgcctatgaggacaacagtctctatcagctcttctacctggccaacctg
aacaaggacttcgaggagaagtccaggctgacctcagtgcctaccctcaggaggtttgct
gtgcccctccacgtggacaaggatgcagaagtgggctcgaatttagtcaaggtgtcatct
acaacagcaactgccctgaaggagaaggacgaccatgtctactgccagcctgaggtcctc
tacgaaggcctagagctccctcggataaattatgctcacaacgggaagccatatcgctac
atctttgctgctgaagtacaatggagtccagtcccaaccaagatactaaaatatgacgtt
ctcaccaagtcctccttaaagtggtccgaggagagctgctggcctgcagagcctctgttt
gtccccacaccgggtgcgaaggatgaggatgatggagtcatcttatcagccatcatctct
acagatccccaaaagctgccctttttacttattctggatgcgaaaagttttacggaattg
gctcgcgcctctgttgatgtggacatgcacctggacctgcatggtttatttattccggat
gcaggctggaatgcagtgaagcagactccagccaaaacgcaagaggatgaaaattcagat
catcccacaggtctgacagcaccaggattgggccatggtgaaaatgacttcacggcaggt
catggcggcaagagcctttaa

DBGET integrated database retrieval system