KEGG   Rattus norvegicus (rat): 114496
Entry
114496            CDS       T01003                                 

Gene name
Bik, Biklk, Blk
Definition
(RefSeq) BCL2-interacting killer
  KO
K18452  Bcl-2-interacting killer
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    114496 (Bik)
SSDB
Motif
Pfam: bcl-2I13 BID
Other DBs
NCBI-GeneID: 114496
NCBI-ProteinID: NP_446156
RGD: 621547
Ensembl: ENSRNOG00000010359
UniProt: Q925D2
Position
7q34
AA seq 158 aa
MSEARLMARDIIKTLLHDQVPQPAVVSGAPSMKEPVGVEDVSPVRDLDFMRCLESRNQVA
LRLACIGDEMDRCLRSPRLVQLPGIAMHRLAATYSQTGVRGIFRSLIGSLTNLRENIWSW
RVFTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWHLQLQ
NT seq 477 nt   +upstreamnt  +downstreamnt
atgtcagaggcgagactaatggccagagacattatcaagactcttctacacgaccaggtc
ccccaacctgcagtggtctctggggctcccagcatgaaggagcctgtgggggttgaggac
gtcagtcctgtgagagacttggatttcatgaggtgcctggagagcagaaaccaggtggcc
ctgaggctagcctgcatcggcgatgagatggaccggtgtcttcggagcccccgtctggtc
cagctgcctgggattgctatgcacagacttgctgccacctacagccagacgggtgtcaga
ggtattttcagaagcttgattggaagcctcaccaacctcagggaaaatatctggtcctgg
agagtcttcactcctggcgcctgggtgtcacctgaccaggaccctgggcagctgtttccc
atggtgctgctggtcttcttgctgctgggtggggcctggcatttgcagcttcagtga

DBGET integrated database retrieval system