KEGG   Rattus norvegicus (rat): 114553
Entry
114553            CDS       T01003                                 

Gene name
Ncf1
Definition
(RefSeq) neutrophil cytosolic factor 1
  KO
K08011  neutrophil cytosolic factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04613  Neutrophil extracellular trap formation
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
rno05020  Prion disease
rno05140  Leishmaniasis
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    114553 (Ncf1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    114553 (Ncf1)
   04666 Fc gamma R-mediated phagocytosis
    114553 (Ncf1)
   04670 Leukocyte transendothelial migration
    114553 (Ncf1)
   04062 Chemokine signaling pathway
    114553 (Ncf1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    114553 (Ncf1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    114553 (Ncf1)
  09164 Neurodegenerative disease
   05020 Prion disease
    114553 (Ncf1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114553 (Ncf1)
   05418 Fluid shear stress and atherosclerosis
    114553 (Ncf1)
   05415 Diabetic cardiomyopathy
    114553 (Ncf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    114553 (Ncf1)
Membrane trafficking [BR:rno04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    114553 (Ncf1)
SSDB
Motif
Pfam: SH3_1 NECFESHC SH3_9 p47_phox_C PX SH3_2 hSH3 SH3_3 SH3_6
Other DBs
NCBI-GeneID: 114553
NCBI-ProteinID: NP_446186
RGD: 61307
Ensembl: ENSRNOG00000001480
Vega: OTTRNOG00000000213
UniProt: Q811Y3
Position
12
AA seq 389 aa
MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRKFTEIYEFHKMLKEMFPI
EAGEIHTENRVIPHLPAPRWYDGQRAAESRQGTLTEYFNSLMGLPVKISRCPHLLNFFKV
RPDDLKLPNDSQVKKPETYLTAKDGKNNVADITGPIILQTYRAIADYEKGSKTEMTVATG
DVVDVVEKSESGWWFCQMKTKRGWVPASYLEPLDSPDEAEDPDPNYAGEPYVTIKAYAAV
EEDEVSLSEGEAIEVIHKLLDGWWVVRKGDITGYFPSMYLQKAGEEITQAQRQIRSRGAP
PRRSTIRNAQSIHQRSRKRLSQDTYRRNSVRFLQQRRRPARPGPQSPDSKDNPSTPRAKP
QPAVPPRPSSDLILHRCTESTKRKLTSAV
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgggggacaccttcattcgccacatcgccctcctgggcttcgagaaacgcttcgtcccc
agccaacactatgtgtacatgttcctggttaagtggcaggacctgtcggagaaggtggtc
tacagaaaattcaccgagatctacgagttccataaaatgttaaaggagatgttccccatt
gaggccggtgagatccacacagaaaacagagtcatccctcacctcccagctcccaggtgg
tatgatgggcagcgtgcagcggagagccgccagggaacgctcaccgagtacttcaacagc
ctcatgggactgcccgtgaagatctcccgctgcccacacctcttgaacttcttcaaagtg
cggcccgatgacctgaagctgcccaatgacagccaggtgaagaagccagagacatacctg
acggccaaagatggcaagaataatgtagctgacatcacgggtcccatcatccttcagacc
tatcgggccatcgctgactacgagaagggttccaaaacagagatgaccgtggcgacggga
gatgtggtggatgtcgtagagaaaagcgagagtggctggtggttttgccagatgaagaca
aaacgaggttgggtccctgcatcctatttggagccccttgacagccctgatgaggcagag
gaccccgatcccaactacgcaggtgaaccgtatgtaaccatcaaagcgtacgctgctgtt
gaagaggatgaggtgtccctgtctgagggtgaagccatcgaggtcattcataagctccta
gatggctggtgggtggtcaggaaaggggacatcaccggctacttcccatccatgtatctg
cagaaggctggggaggagataacccaggcccagcgacagattagaagccgcggggcacca
cctcgcaggtcgaccatccgcaatgcacagagcatccaccagcgttctcggaagcgcctc
agccaggacacctatcgccgcaacagcgtccgattcctgcagcagcgcagacgcccggcg
cgacctgggccgcagagccctgactcaaaggacaatccatcgactccgcgcgccaaacca
cagcctgcggtgcctccgagacccagctcggacctcatcctgcaccgctgcacagagagc
accaagaggaaactgacgtccgccgtgtga

DBGET integrated database retrieval system