KEGG   Rattus norvegicus (rat): 116479
Entry
116479            CDS       T01003                                 

Gene name
F11r, Jam1
Definition
(RefSeq) F11 receptor
  KO
K06089  junctional adhesion molecule 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno04530  Tight junction
rno04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    116479 (F11r)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    116479 (F11r)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    116479 (F11r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    116479 (F11r)
CD molecules [BR:rno04090]
 Proteins
  116479 (F11r)
SSDB
Motif
Pfam: Ig_3 ig I-set Ig_2 V-set C1-set C2-set_2 Ig_6 Adeno_E3_CR1 Ig_C17orf99 Invasin_D3
Other DBs
NCBI-GeneID: 116479
NCBI-ProteinID: NP_446248
RGD: 621842
Ensembl: ENSRNOG00000004414
UniProt: Q9JHY1
Position
13q24
AA seq 300 aa
MGTEGKAGSKLLFLFTSMILGSLVQGKGSVYSPQTAVQVPENDSVKLPCIYSGFSSPRVE
WKFVQGSTTALVCYNNQITVPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEDGGQNYGE
VSIHLTVLVPPSKPTVSIPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGVPMLTADAKKT
RAFINSSYTIDPKSGDLVFDPVSAFDSGEYYCEAQNGYGTAMRSEAVRMEAVELNVGGIV
AAVLVTLILLGLLIFGIWFAYSRGYFERTKKGTAPGKKVIYSQPSARSEGEFKQTSSFLV
NT seq 903 nt   +upstreamnt  +downstreamnt
atgggcaccgaggggaaagccgggagcaaactgttgtttctcttcacgtctatgatcctg
ggctccttggtgcaaggcaagggttcggtgtacagtcctcagactgccgtccaggttcct
gagaacgactctgtcaagttgccctgtatctactctggcttctcctcaccccgcgtggag
tggaagttcgtccaaggcagcaccactgcgcttgtgtgctataacaaccagatcacagtt
ccctatgcagaccgcgtcaccttctcatccagtggcatcaccttcagctctgtgacccgg
aaagacaatggagagtatacttgcatggtctctgaggacgggggtcagaactacggggag
gtcagcatccacctcactgtgcttgtgcctccatccaagccgacagtcagtatcccctcc
tctgtcaccattgggaacagggcagtgctgacctgctcagaacacgacggttcccctcct
tctgaatattcctggttcaaggatggggtacctatgcttacagcagatgccaagaaaacc
cgtgccttcatcaattcttcatacaccatcgatccaaagtcaggggatttggtctttgac
cctgtgtcagcctttgatagtggcgaatactactgcgaggcacagaacgggtatgggaca
gccatgaggtcagaggctgtacgcatggaggctgtggagctgaatgtggggggcatcgtg
gcagctgtcctggtaacactgattctccttggactcctgatttttggcatctggtttgcc
tatagccgtggatactttgaaagaacaaagaaagggactgcaccgggtaagaaggtcatt
tacagccagcccagtgctcgcagtgagggagaattcaaacagacctcgtcattcctggtg
tga

DBGET integrated database retrieval system