KEGG   Rattus norvegicus (rat): 116647Help
Entry
116647            CDS       T01003                                 

Gene name
Nlgn1
Definition
(RefSeq) neuroligin 1
  KO
K07378  neuroligin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    116647 (Nlgn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116647 (Nlgn1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    116647 (Nlgn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Sarcoglycan_2
Motif
Other DBs
NCBI-GeneID: 116647
NCBI-ProteinID: NP_446320
RGD: 621117
Ensembl: ENSRNOG00000032576
Vega: OTTRNOG00000002144
UniProt: Q62765
Structure
PDB: 

Position
2q24
AA seq 843 aa AA seqDB search
MALPRCMWPNYVWRAMMACVVHRGSGAPLTLCLLGCLLQTFHVLSQKLDDVDPLVTTNFG
KIRGIKKELNNEILGPVIQFLGVPYAAPPTGEHRFQPPEPPSPWSDIRNATQFAPVCPQN
IIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTEDVKRISKECARKPGKKI
CRKGDIRDSGGPKPVMVYIHGGSYMEGTGNLYDGSVLASYGNVIVITVNYRLGVLGFLST
GDQAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGNR
WSNSTKGLFQRAIAQSGTALSSWAVSFQPAKYARILATKVGCNVSDTVELVECLQKKPYK
ELVDQDVQPARYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVENIV
DSDDGVSASDFDFAVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRHNPETRRKTLLALF
TDHQWVAPAVATADLHSNFGSPTYFYAFYHHCQTDQVPAWADAAHGDEVPYVLGIPMIGP
TELFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWTRYSQ
KDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITLRPTR
KNSTPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELSVTIAVGASLLFLNILAFAALYYK
KDKRRHDVHRRCSPQRTTTNDLTHAPEEEIMSLQMKHTDLDHECESIHPHEVVLRTACPP
DYTLAMRRSPDDVPLMTPNTITMIPNTIPGIQPLHTFNTFTGGQNNTLPHPHPHPHSHST
TRV
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggcacttcccagatgcatgtggccaaattatgtttggagagccatgatggcatgtgtg
gtccacaggggatcgggtgccccgttgactctctgcttgttgggatgtttgctacagact
ttccacgtactctctcaaaagttggatgatgtagacccattggttactactaactttggc
aaaataaggggaattaagaaagaactcaataatgaaattttggggcctgtcattcagttt
cttggggttccatatgctgctccaccaacaggagaacatcgatttcagcctccagaacca
ccatctccctggtctgatatccggaatgccactcagtttgctcctgtatgtccccagaat
atcattgatggcagattgcctgaagttatgcttcctgtgtggttcactaataacttggat
gtggtttcctcatatgtgcaagaccagagtgaagactgtctatacttaaacatctatgtc
ccaactgaagatgtaaaaagaatatccaaggaatgtgccagaaaacccggcaagaaaata
tgtagaaaaggagatattcgggacagtgggggtcccaaaccagtgatggtgtacatccat
ggtggctcttacatggaaggtactggaaatctatatgatgggagtgtgttggcaagctac
ggtaatgtgatcgtcatcacagtcaactatcggcttggggtacttggcttcttgagcaca
ggggatcaggctgccaaaggaaactacgggctccttgacctcatccaggccctcagatgg
accagcgagaacattgggttctttggtggtgaccccttgcgaatcaccgtgtttggatca
ggcgctgggggttcatgtgtcaatctgctgactttatcccattattctgaaggtaaccgt
tggagcaattcaaccaaaggactttttcaacgagcaatagctcagagtggaacagccctt
tccagctgggctgttagtttccagcctgcaaaatacgctagaattctagccacaaaagtt
ggctgcaatgtgtcagatacagtagagttagtagaatgcctgcagaagaagccttacaaa
gaacttgttgatcaagatgttcaaccagcccgataccacatagcctttggacctgtgatc
gatggtgatgtaataccagatgaccctcagatactgatggaacaaggagagttcctcaat
tatgatatcatgttaggagttaaccaaggggaagggttgaagtttgtggaaaacatagta
gatagtgatgatggtgtatcagccagtgattttgactttgctgtctctaattttgttgat
aatttatatggatatcctgaaggcaaagatgttttgagagaaaccattaaattcatgtat
actgactgggctgatcgccataatcctgaaactagaaggaagacattgttggctttgttt
acagaccatcagtgggtagcacccgctgtggctacagcagaccttcactcgaactttggc
tcacctacatacttctatgccttttatcatcattgccaaacagaccaagttccagcttgg
gctgatgcagctcatggggatgaggttccctatgtattgggaatccccatgattggccct
acagagttatttccttgcaatttctccaagaatgatgtgatgttgagtgctgtagtaatg
acatactggacgaattttgctaaaaccggtgacccaaatcaaccagttcctcaagacaca
aaattcattcataccaaacccaaccgctttgaagaagtagcatggaccagatattcccag
aaagaccaactttatctccatattggattaaaaccgagagttaaagaacattacagagcc
aataaggtaaatctctggttggagctggtacctcatctgcataatctcaatgacatttct
cagtatacctcgacaacaactaaagtgccatcaacagacatcactctcagacctacaagg
aaaaattccactccagtcacatcagcctttcccactgccaagcaggatgatcccaaacaa
caaccaagtcccttctcggtagatcaaagggactactccacagagctaagtgtcacaatc
gcagtgggagcctctctgctgtttctgaacatcttggcttttgcagccctatactacaag
aaagacaagaggagacatgatgtccaccggaggtgcagccctcagcgcaccacgaccaac
gacctaacccatgctccagaagaggaaattatgtctctccaaatgaagcacactgacttg
gatcacgagtgtgagtccatccatccacatgaggtggttcttcggaccgcctgcccccca
gattatactcttgctatgaggaggtcaccggatgatgttcctttaatgacacctaacacc
atcacaatgattcccaacactataccagggattcagcccttacatacattcaacacattt
actggaggacagaataatacactgccccacccccaccctcacccccattcacattcaaca
accagggtatag

DBGET integrated database retrieval system