KEGG   Rattus norvegicus (rat): 116670Help
Entry
116670            CDS       T01003                                 

Gene name
Ppp1r12a, M110, MBSP, Mypt1
Definition
(RefSeq) protein phosphatase 1, regulatory subunit 12A
  KO
K06270  protein phosphatase 1 regulatory subunit 12A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04270  Vascular smooth muscle contraction
rno04510  Focal adhesion
rno04611  Platelet activation
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    116670 (Ppp1r12a)
   04022 cGMP-PKG signaling pathway
    116670 (Ppp1r12a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    116670 (Ppp1r12a)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    116670 (Ppp1r12a)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    116670 (Ppp1r12a)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    116670 (Ppp1r12a)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    116670 (Ppp1r12a)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    116670 (Ppp1r12a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    116670 (Ppp1r12a)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     116670 (Ppp1r12a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_2 PRKG1_interact Ank_5 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 116670
NCBI-ProteinID: NP_446342
RGD: 620013
Ensembl: ENSRNOG00000004925
UniProt: Q10728
Position
7q21
AA seq 976 aa AA seqDB search
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD
IAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD
ARQWLNSGHISDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMETVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSP
LIESTANMENNQPQKTFKNKETLIIEPEKNASRIESLEQEKADEEEEGKKDESSCSSEED
EEDDSESEAETDKTKPMASVTNAHTASTQAAPAAVTTPTLSSNQGTPTSPVKKFPTSTTK
ISPKEEERKDESPASWRLGLRKTGSYGALAEITASKEAQKEKDTAGVIRSASSPRLSSSL
DNKEKEKDNKGTRLAYVAPTIPRRLGSTSDIEEKENRESSNLRTSSSYTRRKWEDDLKKN
SSINEGSTYHRSTSNRLWAEDSTEKEKDSAPTAATILVAPTVVSAAASSTTALTTTTAGT
LSSTSEVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSR
STRTREQENEEKDKEEKEKQDKEKQEEKKESEVSREDEYKQKYSRTYDETYARYRPVSTS
SSSTPSSSSLSTLGSSLYASSQLNRPNSLVGITSAYSRGLTKDNEREGEKKEEEKEGEDK
SQPKSIRERRRPREKRRSTGVSFWTQDSDENEQERQSDTEDGSSKRDTQTDSVSRYDSSS
TSSSDRYDSLLGRSASYSYLEERKPYGSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTN
MELTDLKLQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRL
KDENGALIRVISKLSK
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggcggacgcgaagcagaagcggaacgagcagctgaagcgctggatcggctcc
gagacggacctcgagcctcccgtggtgaagcgccagaagaccaaggtgaagttcgacgat
ggcgccgtcttcctcgccgcctgctccagcggcgacacggacgaggtcctcaagctgctg
caccgcggcgccgacatcaattacgccaatgtggacggactcaccgccctgcaccaggct
tgcattgatgacaatgttgatatggtgaagtttctggtagaaaatggagcaaatatcaat
caacctgacaatgaaggctggattccactccatgcagccgcttcctgtggatatctggat
attgcagaatttttgattggtcaaggagcacatgtaggagctgtcaacagtgaaggtgac
acacctttagatattgcagaggaggaagcaatggaagagctacttcaaaatgaggttaat
cggcaaggtgttgatatagaagcagctcgaaaagaagaggaacgcataatgcttagagac
gcgaggcagtggttgaacagtggtcacatcagtgacgtccggcatgcaaagtccggaggc
acagcactccacgtggcagcggccaaagggtatacagaagttttaaaacttttaatacag
gcaggctatgatgttaatattaaagattatgatggctggacacctcttcatgctgcagct
cactggggtaaagaagaagcatgtcggattttagtggacaatctgtgtgatatggagacg
gtcaacaaagtgggccaaacagcctttgatgtagcagatgaagacattttgggatatcta
gaggagttgcaaaaaaaacaaaatctgctccatagtgaaaagcgggataagaaatctcca
ctgattgaatcaacagcaaatatggaaaataatcaaccacagaagacttttaaaaacaag
gaaacgttgattattgagccagagaaaaatgcatctcgaatcgagtctctggagcaagaa
aaggctgatgaggaggaggaaggcaagaaggatgagtccagctgctccagtgaggaggat
gaggaggatgactccgagtccgaagcggagacagataagacaaaacccatggcttctgta
actaatgctcacactgccagcactcaggcagctcctgccgctgtgacaacacctactctg
tcttccaaccaggggacccctacatcacctgttaaaaagtttcctacatcaactacaaaa
atttctcccaaagaagaagaaagaaaagatgaatctcctgcatcctggaggttaggactt
agaaagactggcagttatggtgccctggctgagatcactgcatctaaagaagctcagaag
gagaaagacactgcaggcgtgatacgttcagcttcgagtcccagactctcgtcctctttg
gataataaagaaaaggagaaagacaataaaggaacaagacttgcatatgtcgcccctaca
atcccaaggcgactaggcagtacgtctgacattgaagagaaggaaaacagagagtcttca
aatttgcgaacaagtagttcttacacaagaagaaaatgggaagatgatcttaaaaaaaat
agttcaatcaatgaaggatctacttaccatagaagtacctcaaatcgtttgtgggctgag
gatagtactgagaaagagaaggacagtgctcctaccgcagcgaccattcttgttgctcca
actgttgtaagtgctgcagcttcttctaccacagccctgaccacaactactgctggcact
ctttcctccacatcagaggtcagggagagacgcaggtcatacctcactcctgttagggat
gaagagtctgaatcccaaaggaaagcaagatctagacaagcaagacagtctagacggtca
acacagggggtgacactgactgacctccaggaagccgaaaagacaataggaagaagccgt
tctacgagaaccagagaacaagaaaacgaagaaaaagacaaagaagaaaaggaaaagcag
gataaagagaaacaagaagaaaagaaggagtcagaagtatctagagaagatgaatataag
caaaagtattccagaacatacgatgagacttatgcacgttacagaccagtgtcaacttca
agttcaagcactccgtcgtcctcctcactttctactctaggcagttcactctatgcctca
agtcagctcaacaggccaaacagccttgtaggtataacctctgcctactcccggggatta
accaaagacaatgaaagagagggagagaaaaaagaagaggaaaaagaaggggaagataag
tcacaacctaaatcaatcagagaacgacggcgaccaagagaaaaacggaggtctactgga
gtctccttctggacacaagatagtgatgaaaatgagcaagagcggcagtcagacaccgag
gatggctccagcaagagggacactcagacggattctgtttccaggtatgacagcagttcc
acgtcatcaagcgatcggtatgactccttgctgggtcgttctgcctcatacagttactta
gaagaaaggaaaccatatggtagccgactagaaaaggatgactcaactgacttcaaaaag
ctttatgaacaaatcttagctgaaaatgaaaaactaaaggcacagctacatgacacaaat
atggaactaacggatctaaagttgcagttggaaaaagctacccagagacaagaacgattt
gctgacaggtcactattggagatggaaaaaagggaacgaagagctctagaaagaagaata
tctgagatggaagaggagctcaaaatgttaccagacttaaaagcagacaaccagaggcta
aaggatgaaaatggggccttgatcagagttataagcaaactttccaagtag

DBGET integrated database retrieval system