KEGG   Rattus norvegicus (rat): 117152
Entry
117152            CDS       T01003                                 

Gene name
Cand1, Tip120, Tip120A
Definition
(RefSeq) cullin-associated and neddylation-dissociated 1
  KO
K17263  cullin-associated NEDD8-dissociated protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    117152 (Cand1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    117152 (Cand1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    117152 (Cand1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   117152 (Cand1)
SSDB
Motif
Pfam: TIP120 HEAT_2 HEAT_EZ HEAT UME Vac14_Fab1_bd CLASP_N Adaptin_N Cnd1 Telomere_reg-2 MMS19_C RTP1_C1 DUF3385 MMS19_N VHS V-ATPase_H_C Uso1_p115_head RRN3
Other DBs
NCBI-GeneID: 117152
NCBI-ProteinID: NP_446456
RGD: 620479
Ensembl: ENSRNOG00000007834
UniProt: P97536
Position
7q22
AA seq 1230 aa
MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDK
NGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKEQLRDISSIGLKTVIGELPPA
SSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADMLSRQGGLLVNFHPSILTCL
LPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELSKNDSMSTTRTYIQCIAA
ISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINI
CLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAV
VSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQ
GETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGI
IFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEAL
LVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNL
GDNLGPDLSNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLR
KNQRALKLGTLSALDILIKNYSDSLTAAMIDAVLDELPPLISESDMHVSQMAISFLTTLA
KVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLT
GPVYSQSTALTHKQSYYSIAKCVAALTRACPKEGPAVVGQFIQDVKNSRSTDSIRLLALL
SLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEIT
SQPKRQYLLLHSLKEIISSASVVGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTL
IDPETLLPRLKGYLISGSSYARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDL
NVRRVALVTFNSAAHNKPSLIRDLLDSVLPHLYNETKVRKELIREVEMGPFKHTVDDGLD
IRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQ
RLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQS
QISSNPELAAIFESIQKDSSSTNLESMDTS
NT seq 3693 nt   +upstreamnt  +downstreamnt
atggcgagcgcttcgtaccacatctccaacttgctggaaaaaatgacatccagcgacaag
gacttcaggtttatggctacaaatgatctgatgacagaactgcagaaagactccatcaag
ctggatgatgacagcgaaaggaaagtcgtaaagatgattctgaagttgctggaggataaa
aatggcgaagtgcagaacttagctgtgaaatgtcttggtcctttagtgagtaaagtgaaa
gagtaccaagttgagacgattgtagacaccctctgtacaaacatgctttctgacaaggag
cagcttcgagatatttccagtattggccttaaaacagtaattggagaactccctccagct
tccagtggctctgcattagctgctaatgtatgtaaaaagattactggacgccttaccagt
gcaatagcaaagcaggaagatgtttctgttcagctagaagctttagatattatggctgat
atgttgagcaggcaaggaggactgcttgttaatttccatccttcaattctgacctgtcta
cttccccagctgactagccctagacttgcagtcaggaaaagaacaattattgctcttggc
cacctagttatgagctgcggaaacatagtttttgtagaccttattgaacatctgttgtca
gagttgtccaaaaatgactccatgtcaacaacaaggacctacatacagtgtattgctgct
attagtaggcaagctggccatagaataggtgaataccttgaaaagataattcctttggtg
gtaaaattttgtaatgtagatgatgatgaattaagagaatactgcattcaagcttttgaa
tcatttgtgagaagatgccctaaggaagtttatcctcatgtttctaccattataaacatt
tgtctaaaataccttacctatgatccaaattacaactatgatgatgaagatgaagatgag
aatgctatggatgctgatggcggagatgacgatgaccaagggagtgacgatgaatacagt
gatgacgatgacatgagttggaaagtgaggcgtgcggctgccaagtgcctggatgccgta
gttagcacacggcatgagatgctcccggaattctacaagaccgtctctcctgcactgata
tccagatttaaagagcgcgaagagaatgtaaaggcagatgtttttcatgcatacctttct
cttttgaagcaaactcgtccagtacaaagttggctgtgcgaccctgatgcaatggagcaa
ggagaaacacccttaacaatgcttcagagtcaggttcccaacattgttaaagccctacat
aaacagatgaaagaaaaaagtgtaaagacccgacagtgttgttttaacatgttaactgaa
ctggtaaatgtgttgcctggggcactaacccaacacattcctgtacttgtaccaggaatc
attttctcactcaatgataagtccagctcatcgaatctgaagattgatgcattgtcctgt
ctgtatgtgatcctctgtaaccactctccgcaagttttccacccgcatgttcaggctttg
gtccctccagtggtggcttgtgttggtgacccattttacaagatcacatcagaagccctt
cttgtcactcagcagcttgtcaaagtaatccgtcctctggaccaaccctcctccttcgat
gcaacgccttacatcaaagatctcttcacttgtacaattaagcgcttaaaagcagctgac
attgatcaggaagtcaaggagagggctatttcctgtatgggacagattatttgcaatctt
ggagacaatttgggccctgacttatcaaatacacttcagattttcttggagagactcaag
aatgaaatcacccggctaacgacagtgaaagcactgaccctgattgctgggtcacctttg
aagatagatctgaggcctgtgctgggagagggagtccctatccttgcttcatttctcagg
aaaaatcagagagctttgaaactggggaccctctctgccctagatattctcattaaaaac
tatagtgacagtttgacggccgccatgattgatgcagttctggatgagctccctcctctt
atcagcgaaagtgatatgcacgtgtcccagatggctatcagcttccttactaccctggca
aaagtatatccctcctccctttcaaagataagcggatctattctcaatgaactgattgga
cttgtaaggtcacctctgctgcagggaggagctcttagtgccatgctagacttcttccaa
gctttggttgtcactggaacaaacaatctaggatacatggatttgctgcgcatgctaacg
ggtccagtttactctcagagcacagctcttactcataagcagtcttactattccattgcc
aaatgtgtagctgcccttactcgagcatgccctaaagagggaccggctgtagtaggtcag
tttattcaagatgtcaagaactccaggtctacagattccattcgtctcttagcgctcctt
tctctaggagaagttggacaccatattgacttaagtgggcagttggagctaaaatctgta
atattagaggctttctcctctcctagtgaagaagttaaatcagctgcatcctatgcgtta
ggcagcatcagtgtaggcaacctccctgagtatctgccatttgtactacaagaaataacc
agtcagcccaaaaggcagtacctgctgctgcattccctgaaggaaatcattagctctgcg
tcagtggtcggccttaagccgtatgtcgagaacatctgggccttgctgctaaagcactgt
gagtgcgcggaggagggcaccagaaacgtcgtcgccgagtgtctagggaagctcactctt
attgatcctgaaactctcctcccgaggcttaaagggtatttgatatcagggtcatcctat
gccagaagctcagtggttacagctgtgaagttcactatttctgaccaccctcagcccatt
gatccactgctcaagaactgcataggtgattttctaaaaacgttggaagacccagatttg
aatgtaagaagagtggccttggtcacattcaattctgcagcccataacaagccgtcactg
atacgggaccttctggattctgttcttccacatctttacaatgagacaaaagttaggaag
gaacttataagagaggtagagatgggcccgtttaagcacacggttgatgacggcctggac
attagaaaggcagcttttgagtgtatgtacacacttctagacagctgtcttgacagactg
gatatctttgaatttctaaatcatgtggaagatggtttgaaggaccattatgatattaag
atgctaacatttttaatgttggtgagactatctaccctttgtccaagtgcagtactacag
aggttggaccggcttgttgagccactacgagctacgtgtacaactaaggtgaaggcgaac
tctgtaaagcaggagtttgaaaagcaggacgagttaaagcgctcggccatgagggcagta
gctgcactgctcaccattccagaggcagagaagagccctctcatgagtgagttccagtca
cagatcagctccaacccggagctggcagccatctttgaaagtatccagaaagattcttcg
tccactaacttggaatcaatggacactagttag

DBGET integrated database retrieval system