KEGG   Rattus norvegicus (rat): 117184
Entry
117184            CDS       T01003                                 

Gene name
Ctrl
Definition
(RefSeq) chymotrypsin-like protease CTRL-1 precursor
  KO
K09632  chymotrypsin-like protease [EC:3.4.21.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04972  Pancreatic secretion
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    117184 (Ctrl)
   04974 Protein digestion and absorption
    117184 (Ctrl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    117184 (Ctrl)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     117184 (Ctrl)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   117184 (Ctrl)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 DUF316 Pico_P2A He_PIG Peptidase_C37
Other DBs
NCBI-GeneID: 117184
NCBI-ProteinID: NP_446461
RGD: 621501
Ensembl: ENSRNOG00000019353
UniProt: Q9EQZ8
Position
19
AA seq 264 aa
MLLLSLTLSLVLLGSSWGCGVPAITPALSYNQRIVNGENAVPGSWPWQVSLQDNTGFHFC
GGSLIAPNWVVTAAHCKVTPGRHFVILGEYDRSSNAEPIQVLSISKAITHPSWNPNTMNN
DLTLLKLASPARYTAQVSPVCLASSNEALPAGLTCVTTGWGRISGVGNVTPARLQQVVLP
LVTVNQCRQYWGSRITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTENCN
VQAPAMYTRVSKFNTWINQVIAYN
NT seq 795 nt   +upstreamnt  +downstreamnt
atgttactgctcagcctaacccttagcctggtccttcttggctcctcctggggctgtggt
gttcccgccatcacacctgcactgagctacaaccagaggattgtcaacggggagaatgca
gtgccaggctcctggccctggcaagtgtctctgcaggataacaccggcttccacttctgt
ggtggttctctcattgccccaaactgggtggtcacggctgcccactgcaaagtcacgcct
ggacgccactttgtcattttaggagaatatgaccgatcttccaatgctgagcctatacag
gtgctctccatctcgaaggcgatcacacaccctagctggaaccccaacactatgaacaat
gacctgactcttctgaagcttgcctcaccagcccggtacacagcacaagtctcaccagtc
tgcctggcttcctcaaatgaggcacttcctgcaggcctcacatgcgtcaccactggctgg
ggccgcatcagtggtgtgggcaacgtgacaccagcacgtctgcagcaagtagttctaccc
ctggtcactgtgaatcagtgtcggcagtattggggttcacgcattactgactccatgata
tgtgcaggtggcgcaggtgcctcctcatgtcagggtgactcaggaggccctcttgtctgc
cagaagggaaacacctgggtgcttattggtattgtctcctggggcactgagaactgcaat
gtacaagcaccggccatgtacactcgggtcagcaagttcaacacctggatcaaccaagtc
atagcctacaactaa

DBGET integrated database retrieval system