KEGG   Rattus norvegicus (rat): 117265
Entry
117265            CDS       T01003                                 

Gene name
Pex6, Paf-2, Paf2
Definition
(RefSeq) peroxisomal biogenesis factor 6
  KO
K13339  peroxin-6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    117265 (Pex6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    117265 (Pex6)
Membrane trafficking [BR:rno04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    117265 (Pex6)
SSDB
Motif
Pfam: AAA AAA_16 AAA_lid_3 AAA_22 AAA_33 AAA_5 AAA_11 RuvB_N NACHT AAA_25 TsaE TIP49 AAA_18 AAA_19 RNA_helicase AAA_30 AAA_7 Mg_chelatase NTPase_1 Vps4_C IstB_IS21 DUF2075 AAA_2 PhoH
Other DBs
NCBI-GeneID: 117265
NCBI-ProteinID: NP_476466
RGD: 621637
Ensembl: ENSRNOG00000016655
UniProt: P54777
Position
9q12
AA seq 978 aa
MALAVLHVLEPFPTETPPLAVLLPPGGPWPVTGVGLVLALRPASESPAGPALLVAAVEGS
GAQCEQRGPGPPPLLVSRTLLRVLALSPGARVRARPVRRPPALGWALLGTSPGPGLGPRV
GPLLVRRGETLPVPGSRVLETRPALQGLLGPGTRLAVTELQGRTKLDPESRDHNHPPPPP
VVSSFAVSHSIRQLRGVLGGTGDALGVSRSCLRSLGLFQGEWVWVARVGELPNTSQPHLA
QVQVLEPRWDLSARLGPNSGQPGEPLADGLVFVPATLAFNLGCDPLEVGELRIQRYLEDS
TAAEDKGSCSLLPGPPFARELHIEVLPSPHCGVNGKYDHVLYQHFHTPRVVQEGDVLCVS
TAGQVEILEGSLERLPRWREVFFKVKKTVGEAPDGPASAFLADTTHTSLYLAGTTLSRVP
PLPSGRSPPWDSLSPPGLEALVNELCAVLKPHLQPGGTLLTGTSCVLLQGPPGSGKTTAV
TAACSRLGLHLLKVPCSSLCADSSRTVETKLQTTFSRARRCRPVVLLLTALDLLGRDRDG
LGEDARVVATLRHLLLDEDPLSRCPPLMVVATTSRVQDLPTDVRTAFPHELEVPVLSESQ
RLSVLQALTAHLPLGQEVNLSQLARRCAGFVVGDLYALLTHASRAACTRIKAAGLAMSEE
DEGELCAAGFPLLAEDFGQALDQLQTAHSQAVGAPKIPSVSWHDVGGLQDVKKEILETIQ
LPLEHPELLSLGLRRSGLLLHGPPGTGKTLLAKAVATECSLTFLSVKGPELINMYVGQSE
ENVREVFARARAAAPCIIFFDELDSLAPSRGRSGDSGGVMDRVVSQLLAELDGLHSTQDV
FVIGATNRPDLLDPALLRPGRFDKLVFVGASEDRASQLRVLSAITRKFKLEASVSLMNVL
DCCPPQLTGADLYSLCSDAMMTALKRRVRDLEEGLEPRSSALLLTMEDLLQAAARLQPSV
SEQELLRYKRIQRKFAAC
NT seq 2937 nt   +upstreamnt  +downstreamnt
atggcgcttgctgtattgcatgtcctagaacccttcccgactgagacaccaccgttggcg
gtgctgttgccgcccgggggcccgtggccagtgaccggggtaggcctggtgctggcgcta
cggccggcgagcgaaagtcctgcgggacccgcgctgctcgtggcggccgtggaagggtcc
ggcgcccaatgcgagcagcgagggcccgggcctccgccgctgctggtgagccgcacgctg
ctgcgggtcctagcgctgagccccggagcgagagtgcgagcgcggcctgtgcggcggcct
ccagccttgggctgggcgctgcttggcacgtctccgggtcctgggcttgggcctcgagtc
gggccgctgctggtgcgtcgcggggagacactaccggtgcccggttctcgagtgttggag
acgcgaccggccttgcaagggttgctgggcccggggacacggctagctgtaactgagctc
caggggcggaccaaactggacccggagagtagggaccacaaccatcccccacccccgccc
gtagtttcctcctttgcagtttcccactcaatccggcagctccgaggagttctgggaggg
actggagatgcactaggtgtgagccggagctgtctccggagtctcgggctcttccagggc
gaatgggtatgggtggcccgagtcggagagttaccaaacacctcccagccgcacttggct
caagtacaggttctagagcctcgctgggacctgtccgcgagactgggacccaactctggg
cagccgggagagccactcgcggacggactggtgtttgtgcctgccactctagcttttaat
ctcggctgtgaccccctggaagtgggagagctcagaattcagaggtatctggaagactct
actgctgctgaggacaaaggaagctgctcactactgcctgggcctccgtttgctcgagag
ttacacatcgaagttctgccctcgcctcactgtggtgtcaatgggaaatatgaccatgtt
ctctaccagcacttccacacgcccagggtggtccaggaaggggatgttctgtgtgtgtca
acggctgggcaagttgagatcctggaaggaagcctggagagactgcccaggtggcgggag
gtgtttttcaaagtgaagaaaacggttggagaagccccagatgggccagccagtgccttc
ctggccgataccacacacacctctttatacctggctggtaccaccctgagtcgtgtcccc
ccgctgccttcaggaaggtccccaccctgggacagcttgtctcctccaggcctggaggcc
ttggtaaatgagctgtgtgctgtcctgaagcctcatctgcagcccggaggaacactgctc
acaggaaccagctgtgtgctcctgcagggtcccccaggcagcgggaagaccaccgcggtc
acagctgcatgcagtcgcctcgggctccatctgctgaaggtgccttgctccagcctctgt
gcagatagcagtaggactgtggagacaaagctgcagaccaccttctcccgggcccgccgc
tgcaggcctgtggtcctcctgctgacagccctggaccttctgggccgggaccgagatggg
ctgggtgaggatgcccgcgttgtggccacactgcgtcacctcctcctcgatgaggaccct
ctgagcaggtgccctcctctcatggtggtggccactacaagccgtgtccaggacctgccc
accgatgtgcggacggcatttcctcatgagctggaggtgccagtgttgtctgagagtcag
cggctcagtgtcctgcaggccctcactgcccatcttcccttgggccaggaggttaacctg
tcacagctggcacggcgctgtgcgggctttgtggtaggggacctctatgcccttctgacc
catgccagccgggcagcctgcaccaggatcaaagctgcaggcttggcgatgagtgaggag
gatgagggggagctgtgtgccgctggctttcccctgttggccgaggacttcgggcaggcg
ttagatcaactacaaacggctcactcccaagcagtaggagcgcccaagatcccttcagtg
tcctggcacgatgtgggtgggctgcaggatgtgaagaaggagatcctggagaccatccaa
ctgcctctggaacaccctgagctgctaagcctgggcctaagacgatcaggccttctgctc
catgggcccccaggcactggcaagaccctgctggccaaggcggtagccactgagtgcagc
ctcacctttctcagtgtaaaggggccagaactcatcaacatgtatgtgggccaaagtgag
gagaatgttcgggaagtgtttgccagggccagggctgctgccccgtgcatcatcttcttt
gatgaactggactccttagctccgagccgtggacggagtggagactctggaggtgtgatg
gacagagttgtgtctcagctcttagctgagctggacgggcttcacagcactcaggatgtg
tttgtgatcggagccaccaacagaccagacctcctggatcctgcccttctgcggcctggc
agatttgacaagctggtgtttgtaggagcaagtgaggaccgggcctcccagctgcgcgtt
ctgagcgccatcacacgaaagttcaagctggaggcctctgtgagcctgatgaatgtgctg
gattgctgcccgcctcagctgaccggcgcagacctctattctctctgctctgacgccatg
atgaccgccctcaaacgcagggtccgagacctagaggaagggctggagcctcggagctca
gcactgttgctcaccatggaggacctgttgcaggccgcagcccggctgcagccctcagtc
agcgagcaggagctgctgcgatacaagcgtatccaacgcaagtttgctgcctgctag

DBGET integrated database retrieval system