KEGG   Rattus norvegicus (rat): 117516
Entry
117516            CDS       T01003                                 

Gene name
Tnfsf11
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 11
  KO
K05473  tumor necrosis factor ligand superfamily member 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04064  NF-kappa B signaling pathway
rno04380  Osteoclast differentiation
rno04917  Prolactin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno05224  Breast cancer
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    117516 (Tnfsf11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    117516 (Tnfsf11)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    117516 (Tnfsf11)
   04928 Parathyroid hormone synthesis, secretion and action
    117516 (Tnfsf11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    117516 (Tnfsf11)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    117516 (Tnfsf11)
  09163 Immune disease
   05323 Rheumatoid arthritis
    117516 (Tnfsf11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    117516 (Tnfsf11)
   04090 CD molecules [BR:rno04090]
    117516 (Tnfsf11)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Tumor necrosis fators
   117516 (Tnfsf11)
CD molecules [BR:rno04090]
 Proteins
  117516 (Tnfsf11)
SSDB
Motif
Pfam: TNF DUF6264
Other DBs
NCBI-GeneID: 117516
NCBI-ProteinID: NP_476490
RGD: 620784
Ensembl: ENSRNOG00000049547
UniProt: Q9ESE2
Position
15
AA seq 318 aa
MRRANRDYGKYLRGSEEMGSCPGVPHEGPLHPAPSAPAPAPPPAASRFMFLALLGLGLGQ
VVCSIALFLYFRAQMDPNRISEDSTRCFYRILRLRENTGLQDSTLESEDTEALPDSCRRM
KQAFQGAVQRELQHIVGPQRFSGVPAMMEGSWLDVARRGKPEAQPFAHLTINAADIPSGS
HKVSLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPADYLQLM
VYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISVQVSNPSLL
DPDQDATYFGAFKVQDID
NT seq 957 nt   +upstreamnt  +downstreamnt
atgcgccgggccaaccgagactacggcaagtacctgcgcggctcggaggagatgggcagt
tgccctggcgtcccacacgagggtccgctgcatcccgcgccttcagcaccggctccagcg
ccgccccccgccgcctcccgcttcatgttcctggcgctcctggggctgggactgggtcag
gtggtctgcagcatcgctctgttcctgtactttcgagcgcagatggatcctaacagaata
tcagaagacagcacgcgctgcttctacagaattctgagactccgtgaaaatacaggtttg
caggactcgactctggagagcgaagacacagaagcactacctgactcatgcaggagaatg
aaacaagcctttcaaggggccgtgcaaagggaattacaacacattgtggggccacagcgc
ttctcaggagttccagctatgatggaaggttcgtggctcgatgtggcccggcggggcaag
cctgaggctcagccgtttgctcacctcaccatcaatgctgccgacatcccatcgggttcc
cataaagtcagtctgtcctcttggtaccatgatcgaggctgggccaagatctctaacatg
acgttaagcaacggaaaactaagggttaaccaagatggcttctattacctgtacgccaac
atttgcttcaggcatcatgaaacctcagggagcgtacctgcggactatcttcagctgatg
gtatatgtcgttaaaaccagcatcaaaatcccaagttcgcataacctgatgaaagggggg
agcactaagaactggtcagggaattctgaattccacttttattccataaacgttggagga
tttttcaagctccgggctggtgaggaaattagcgtccaggtgtccaacccttccctgttg
gatccggatcaagatgcgacgtactttggggctttcaaagttcaagacatagactga

DBGET integrated database retrieval system