KEGG   Rattus norvegicus (rat): 117519
Entry
117519            CDS       T01003                                 

Gene name
Keap1, Inrf2
Definition
(RefSeq) Kelch-like ECH-associated protein 1
  KO
K10456  kelch-like protein 19
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno05200  Pathways in cancer
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    117519 (Keap1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    117519 (Keap1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    117519 (Keap1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    117519 (Keap1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    117519 (Keap1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     117519 (Keap1)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 Kelch_3 BTB BACK Kelch_2 Kelch_4
Other DBs
NCBI-GeneID: 117519
NCBI-ProteinID: NP_476493
RGD: 621619
Ensembl: ENSRNOG00000020878
UniProt: G3V8U2
Position
8q13
AA seq 620 aa
MQPEPKPSGAPRSSQFLPLWSKCPEGAGDAVMYASTECKAEVTPSQDGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYEDIPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISVGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCTELHQRAREYIYMHFGEEEFFNLSHCQLATLISRDDLNVRCESE
VFHACIDWVKYDCPQRRFYVQALLRAVRCHALTPRFLQTQLQKCEILQADARCKDYLVQI
FQELTLHKPTQAVPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADLQVPRSG
LAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGVIDGH
IYAVGGSHGCIHHSSVERYEPDRDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRL
NSAECYYPERNEWRMITPMNTIRSGAGVCVLHSCIYAAGGYDGQDQLNSVERYDVETETW
TFVASMKHRRSALGIAVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRLTSGRSGV
GVAVTMEPCRKQIDQQNCTC
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgcagcccgaacccaagcctagcggggctccccgcagcagccagttcctgcccctgtgg
tcaaagtgcccggagggggcaggggacgcggtgatgtatgcatccacggagtgcaaggcg
gaggtgacgccctcgcaggatggtaaccgaaccttcagttacacactagaggatcacacc
aagcaggcttttggcatcatgaacgagcttcggctgagccagcagctctgtgacgtgacc
ctgcaggtcaaatatgaggacatcccagctgcccaattcatggcccacaaagtggtgctg
gcctcctccagcccagtctttaaagctatgttcaccaacgggcttcgggagcagggcatg
gaggtggtgtccattgaaggcatccaccccaaggtcatggagaggctaattgagttcgcc
tacacggcctccatctccgtgggcgagaagtgtgtgctgcatgtgatgaacggggcagtc
atgtaccagattgacagcgtggtccgagcctgcagcgacttcctcgtgcagcagctggac
cccagcaacgccatcggcatcgccaacttcgccgagcagatcggctgcacggaactgcac
cagcgtgctcgggagtatatctacatgcacttcggggaggaggagttcttcaacctgtca
cactgccagctggccacgctcatcagccgcgatgatctgaacgtgcgctgcgagtccgag
gtgttccatgcgtgcatcgactgggtcaaatacgactgcccgcagcggcgcttctacgtg
caggcactgctacgggccgtgcgctgccacgctctcacgccacgcttcctgcagacacag
ctgcaaaagtgcgagatcctgcaggccgacgcgcgctgcaaggactacctggtgcagatc
ttccaggagctcacgctgcacaagcccacacaagcggtgccctgccgggcgcccaaagtg
ggccgcctcatctacactgcgggcggttacttccgacagtcgctcagctacctggaggcc
tacaacccgagcaatggctcctggctgcgcctggcagacctacaggtgccccgcagtggg
ctggcgggctgcgtggtgggcgggctgctgtatgctgtgggcggccgcaacaactcgccg
gacggcaacactgattccagcgccctggactgctacaaccccatgaccaaccagtggtcg
ccctgtgcctctatgagcgtgccgcgcaaccgcatcggggtgggggtcatagatggccac
atctacgcagtcgggggttcccacggctgcatccaccacagcagcgtggagagatatgag
ccagatcgagacgagtggcacctagtcgcgccaatgttgacgcggaggatcggcgtgggc
gtggcagtgctcaaccgcttgctgtatgcagtggggggctttgatgggactaaccggctt
aactcggcagaatgttactacccggagaggaatgagtggcggatgattacaccaatgaat
accatccggagcggggccggggtctgtgtgctgcacagctgcatctatgccgcaggaggc
tacgatgggcaggaccagctgaacagcgtggaacgctacgacgtggagacagagacctgg
actttcgtagcctccatgaagcatcgccggagcgcgctggggattgctgtgcaccagggc
aggatctacgtcctcggaggctacgatggccacacttttctggacagtgtggaatgctat
gacccagacactgatacctggagtgaagtgacccgcttgacatctggccgcagtggggtg
ggtgttgctgtcaccatggaaccctgtcggaagcaaattgatcaacaaaactgtacctgc
tga

DBGET integrated database retrieval system