KEGG   Rattus norvegicus (rat): 117542
Entry
117542            CDS       T01003                                 

Gene name
Baiap2, Irsp53
Definition
(RefSeq) BAI1-associated protein 2
  KO
K05627  BAI1-associated protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04520  Adherens junction
rno04810  Regulation of actin cytoskeleton
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    117542 (Baiap2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    117542 (Baiap2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    117542 (Baiap2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    117542 (Baiap2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   I-BAR proteins
    117542 (Baiap2)
SSDB
Motif
Pfam: IMD SH3_2 SH3_9 SH3_1 BAR RasGAP Peptidase_Mx1 BAR_3
Other DBs
NCBI-GeneID: 117542
NCBI-ProteinID: NP_476544
RGD: 619814
Ensembl: ENSRNOG00000004049
UniProt: Q6GMN2
Position
10q32.3
AA seq 522 aa
MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTFAAKGYFDALVKMG
ELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKAFHNELLTQLEQKVELDSRYLSAAL
KKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVS
DGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPNKIPDRA
AQLMQQMANSNGSILPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQENVPVM
NGVAGADSEDYNPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENK
TLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESE
KTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLALPPPDYGTSSRAFP
SQTAGTFKQRPYSVAVPAFSQGLDDYGARSVSSGSGTLVSTV
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgtcgctttcacgctcggaggagatgcaccggctcacggaaaatgtctacaagaccatc
atggagcagttcaaccccagcctccgcaacttcatcgccatggggaagaactatgagaaa
gcactggcaggtgtcaccttcgctgccaaaggctatttcgatgctctggtaaagatgggg
gagctggccagcgagagccagggctctaaggaacttggggacgtcctcttccagatggcc
gaagtccaccggcagatccagaaccagctggaagagatgctgaaggcctttcacaatgag
ctgctcacacagctggagcagaaagtagaactggattccaggtatctgagtgctgcgctg
aagaaataccaaacagaacagaggagcaaaggggacgccctggacaagtgtcaggctgag
ctaaagaagctccgtaagaagagccaagggagtaagaaccctcagaagtactcagacaag
gagctgcagtacatcgatgccatcagcaacaagcagggcgagctggagaactacgtgtct
gacggctacaagacagcactcactgaggagcgcaggaggttctgcttcctggtggaaaag
caatgtgcagtggccaagaactccgctgcctaccactccaagggcaaggagttactagcc
cagaagctgcctttgtggcagcaagcctgtgctgaccccaacaagatcccagaccgtgct
gcccagctgatgcagcagatggccaacagcaatggctccatccttccaagtgccctgtca
gcctccaagtccaacctggtcatctcagaccccattcccggggccaagcccttgccagtg
ccgccggaactggccccgttcgtggggcggatgtctgctcaggagaatgtacctgtcatg
aatggcgtcgcaggcgcggacagcgaggactacaacccctgggccgaccgaaaggctgcc
cagcccaaatccctgtctcccccgcagtctcaaagcaagctgagcgactcgtactccaac
acactccccgtgcgcaagagcgtgaccccgaagaacagctatgccaccactgagaacaag
acgctgccacggtcaagctccatggcagccggcctagaacgtaacggccgcatgcgggtc
aaggccattttctcccacgcggccggcgacaatagcactctgctgagcttcaaggagggc
gacctcatcacgctgctagtgcccgaggcccgagacggctggcactatggcgagagcgag
aagaccaagatgcggggctggttccccttctcctacactcgggtcctggacagcgacgga
agtgacaggttgcacatgagcctgcagcagggtaagagcagcagcacaggcaacctcctg
gacaaggatgacctggccctccctcctcctgactatggcacgtcctcccgggcattcccc
agtcagacagctgggactttcaagcaaagaccctacagtgtggcagttcctgccttctct
cagggtctggatgactacggggcacggtctgtgagcagtggcagtggcacgctggtgtcc
acagtgtga

DBGET integrated database retrieval system