KEGG   Rattus norvegicus (rat): 124461
Entry
124461            CDS       T01003                                 

Gene name
Pacsin2
Definition
(RefSeq) protein kinase C and casein kinase substrate in neurons 2 protein
  KO
K20123  protein kinase C and casein kinase substrate in neurons protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    124461 (Pacsin2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    124461 (Pacsin2)
SSDB
Motif
Pfam: FCH SH3_1 SH3_9 SH3_2 NPF YcgL Tweety SH3BP5
Other DBs
NCBI-GeneID: 124461
NCBI-ProteinID: NP_570096
RGD: 69411
Ensembl: ENSRNOG00000009756
UniProt: Q9QY17 Q6IRI3
Position
7
AA seq 486 aa
MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCGDLMNCLHERARIEKAYAQQLT
EWARRWRQLVEKGPQYGTVEKAWMAVMSEAERVSELHLEVKASLMNEDFEKIKNWQKEAF
HKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVDAAKKAHHTACKEEKLAVSREANSKADP
SLNPEQLKKLQDKIEKCKQDVLKTKDKYEKALKELDQTTPQYMENMEQVFEQCQQFEEKR
LRFFREVLLEVQKHLDLSNVASYKGIYRELEQSIKAADAVEDLRWFRANHGPGMAMNWPQ
FEEWSADLNRTLSRREKKKAADGVTLTGINQTGDQSGQNKPSSNLSVPSNPAQSTQLQSS
YNPFEDEDDTGSSVSEKEDIKAKNVSSYEKTQNYPADWSDDESNNPFSSTDANGDSNPFD
EDTTSGTEVRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPAN
YVEAIQ
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtctgtcacctacgatgattctgtgggagtggaagtgtccagcgacagcttctgggag
gtcgggaactacaaacggactgtgaagcggattgatgatggccaccgcctgtgtggtgac
ctcatgaactgtttgcacgagcgggcacgtatcgagaaggcatatgcacagcagctcact
gagtgggcccgacgctggagacagcttgtagagaagggaccacagtatgggaccgtggag
aaggcctggatggctgtcatgtctgaggcagagagagtgagcgagctacacctggaagtg
aaggcatcactgatgaacgaagactttgagaagatcaagaactggcagaaggaagccttt
cacaagcagatgatgggaggcttcaaggagaccaaggaagcagaggatggctttcggaag
gcccagaagccctgggccaagaagctgaaagaggtggatgcggcaaagaaagcacaccac
acagcgtgcaaagaggagaagctggccgtctcccgggaagccaacagcaaagcagatcca
tccctcaaccctgagcagctgaagaaattgcaagacaagatagaaaagtgcaagcaggac
gttctaaagaccaaggacaagtatgagaaggccctgaaggagcttgaccagactacaccg
cagtacatggagaacatggagcaggtgttcgagcagtgccagcagtttgaagagaagcgc
ctgcgcttcttccgagaggttctgctggaggttcagaagcacttggacctgtccaatgtg
gctagctacaaaggcatttaccgggagctggagcagagcatcaaagcagctgatgctgtg
gaggacctgaggtggttccgagctaaccatgggccaggcatggctatgaactggccacag
tttgaggagtggtctgcagatctgaatcgaactctcagccgaagagagaagaagaaggct
gctgatggtgtcaccctaacaggaatcaaccagacaggtgaccagtctggacagaacaag
cctagcagcaaccttagtgtcccgagcaaccccgcccagtccacgcagttacagtccagc
tacaaccccttcgaggacgaggacgacacgggcagcagcgtcagtgagaaggaggacatt
aaggccaaaaatgtcagcagctatgagaagactcagaattaccccgctgactggtctgat
gatgagtctaacaaccctttctcctccacggatgccaatggggactctaacccgtttgac
gaggacactacctcaggaacagaagtgcgagttcgagccctctatgactatgagggacaa
gaacacgatgagctgagcttcaaggctggggatgagctgaccaagatagaggatgaagat
gaacagggttggtgcaagggacgtttagacagtggccaggttggcctatacccagccaac
tatgtcgaggctatccagtga

DBGET integrated database retrieval system