KEGG   Rattus norvegicus (rat): 140589
Entry
140589            CDS       T01003                                 

Gene name
Gli1
Definition
(RefSeq) zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04340  Hedgehog signaling pathway
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    140589 (Gli1)
   04024 cAMP signaling pathway
    140589 (Gli1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    140589 (Gli1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    140589 (Gli1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    140589 (Gli1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    140589 (Gli1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 zf-C2H2_8 IL17
Other DBs
NCBI-GeneID: 140589
NCBI-ProteinID: NP_001178839
RGD: 621673
Ensembl: ENSRNOG00000025120
UniProt: G3V6X8
Position
7
AA seq 1109 aa
MFNPMTSPQVNSYGEPCCLRPLPSQGVPSMGTEGLSGLPFCHQANFMSGSQGYGSARETS
SCTEGSLFPPPRSSVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGS
YGHLSIGTMSPSLGFPPQMSHQKGTSPPYGVQPCVPHDSTQGSMMLHPQSRGPRATCQLK
SELDIMVGKCPEEPLEGDMSSPNSTSTQDHLLGMLDGREDLEREEKPEPESVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEQEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAQPLSTVEPKREREG
GSGREESRLTVPEGTMPQQSPGAQSSCSSDHSPAGSAANTDSGVEMAGNAGGSTEDLSSL
DEGPCVAATGLSTLRRLENLRLDQLHQLRPIGSRGLKLPSLTHAGAPVSRRLGPPVSLDR
RSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLTPAQHYMLRARYASARGSGT
PPTAAHSLDRIGGLPAPPWRSRAEYPGYNPNAGVTRRASDPARAADHPAPARVQRFKSLG
CVHTPPSVATGRNFDPHLPTSVYSPQPPSITENVAMDTRGLQGELEVGTSMMGNDLNPYM
DFSSADTLGYGGPEGTAAESYGSKGPGSLPLGPGPPTNYGPGHCAQQVSYPDPTPETWGE
FPSHAGVYPGTKALGTAYNQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEGSP
DPQPLFSHHSQLPPPQYLQSGPYPQPPHDCLSLESRPGLNFNPSSHSTGQLKAQLLCNYV
QSQQELLWEGRSRGGIPNQELPYQSPKFLGGSQVSQSPTKVPAAAAAATFGSGFASPALA
NHKSVSYPAPSPCHETFTMGVNRPPHRPAAPPRLLPPLPPCYGPLKVGDANPSCGHPEVG
RLGAGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEAQGLSPPPSHEQGDSSKNTPPP
SGPPNMAVGNMSVLLGSLPGETQFLNSSA
NT seq 3330 nt   +upstreamnt  +downstreamnt
atgttcaatccaatgacttcaccacaagtcaatagctatggtgagccatgctgtctccga
cccctccccagccaaggggtccccagcatgggaacagaaggactttctggtctgcccttt
tgccaccaagccaattttatgtcagggtcccagggttatgggtctgccagagagaccagc
agctgcactgaggggtcactctttcctcctcctcggagttcagtcaaactgactaagaag
cgggctctttccatctcgcctctctctgacgccagcctcgacctgcaaaccgtaatccgt
acctcacccagctccctcgtggctttcatcaactctcgttgtacatctccaggcggttcc
tacggccatctctccattggcaccatgagcccttctttaggattcccacctcagatgagt
caccagaaaggaacttcacctccctatggagtccagccctgtgttccacatgattctact
cagggttcaatgatgcttcacccccagtcccgaggaccacgtgcaacctgccagctgaag
tcagagctggacatcatggttggcaagtgcccagaggaacctttggaaggggacatgtct
agccccaactccacgagcacacaggatcacctgctggggatgctggatggacgggaggac
ctggagagagaggagaaacctgagcctgagtctgtgtatgagacggactgccgctgggat
ggttgcagccaggagttcgattcccaagaacagctggtgcaccacatcaacagtgagcac
atccacggggagcggaaggagttcgtgtgccactggggaggctgctccagggagctgagg
cccttcaaggcccagtacatgctggtggtgcacatgcgcagacacacgggcgagaagcca
cacaagtgcacgtttgaaggctgtcggaagtcctattcacgcctcgaaaacctgaagaca
caccttcggtcgcacaccggtgagaagccttatatgtgtgagcaggaaggctgcagcaag
gccttcagcaacgccagtgaccgtgccaagcaccagaataggacccactccaatgagaag
ccatatgtgtgcaaactccccggctgcaccaagcgctacacagatcccagctcgctccgc
aaacatgtcaagactgtgcacggtccggatgcccacgtgaccaaacgacatcgaggggat
ggccccttaccacgggcacagcccctctccacagtggagcccaagcgagaaagggaagga
ggatccggcagggaagagagcagactgactgtgccggagggcaccatgcctcagcagagc
cctggagcacaatcctcctgcagcagtgaccactccccagcaggcagcgcggccaacacg
gacagcggcgtggagatggccggcaacgcagggggcagcactgaggacttgtccagcttg
gatgaaggaccttgcgttgcggctaccggactctccacccttcgccgccttgagaacctc
aggctggatcagctgcatcagctccggccaatagggtcccggggtctcaaactgcccagc
ttaacccacgctggcgcacctgtgtctcgacgtctgggcccaccggtctcccttgaccgc
cgcagcagcagctccagcagcattagctccgcgtacacagtcagccgccggtcctcgctg
gcatccccgttcccgccgggatccccaccagagaacggggcgtcgtcactacctggcctc
acacctgcccagcactacatgctccgggcaagatatgcttcagccagggggagtggcacc
ccacccactgcagcacacagcctggatcggatcgggggtcttcctgcacctccttggaga
agccgagctgagtacccaggatacaaccccaatgcaggggtcacgaggagggccagtgac
ccagcccgggctgctgaccacccggctccagctagagtacaacggttcaagagcttgggg
tgtgtacacacgcctcctagtgtggcaacaggacggaacttcgatccccacctccctacc
tctgtctattcgccacagccccccagcatcaccgaaaatgttgctatggatactagaggg
ctacagggggagctagaggttggaacttccatgatgggcaatgatctgaacccatacatg
gacttttcttctgctgacactctgggatatggggggcctgaggggacggcggctgagtct
tatggatctaagggtccaggttccctgcctcttgggcctggtccaccaaccaactatggc
cctggccactgtgcccagcaggtctcctatcctgatcccaccccagaaacatggggtgag
tttccttcacatgctggggtgtaccctggcactaaggctctaggtacagcctataaccag
tgtcctcgacttgagcattatggacaagtgcaagtaaaaccagaacaagggtgcccagtg
gggtctgactccaccgggttggcaccctgcctcaatgcccaccccagtgaagggtcccca
gacccacagcctctgttttcacatcactcccagctccctccaccccagtatctccagtca
ggtccctaccctcagcctccccatgactgtctctcgttagaatccaggcctggcctcaat
ttcaacccctcctctcattccacaggacagctcaaagctcagctcctgtgtaattacgtt
cagtcgcagcaggaattgttgtgggagggcagaagccggggagggatccccaaccaggaa
cttccatatcagagccccaagtttctgggaggttctcaagttagtcagagccccaccaag
gtcccagcagcagcagcagcagctacgtttggatctggctttgcatcacctgctttggcc
aatcacaaatcagtctcctatcctgccccttcaccgtgccatgaaactttcaccatggga
gtaaacaggcctccccataggccagcagcaccaccccggcttctgcccccgctaccacct
tgctatgggcccctcaaggtgggagatgccaaccccagctgtgggcatcctgaagtgggc
aggttaggagcaggccctgccttgtaccctccccctgaagggcaggtgtgtaaccctctg
gactctcttgacctggacaacactcagctggactttgtggctatcctagatgaagctcaa
gggctgagccctcctccttcccacgagcaaggggacagctctaaaaacaccccacctccc
tccgggccccccaacatggcagtcggtaacatgagtgtcttactggggtctctgcctgga
gagacgcagttcctcaactctagtgcctaa

DBGET integrated database retrieval system