KEGG   Rattus norvegicus (rat): 140924Help
Entry
140924            CDS       T01003                                 

Gene name
Il2rg, Ab2-183, Cd132
Definition
(RefSeq) interleukin 2 receptor subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04144  Endocytosis
rno04151  PI3K-Akt signaling pathway
rno04630  Jak-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05321  Inflammatory bowel disease (IBD)
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    140924 (Il2rg)
   04151 PI3K-Akt signaling pathway
    140924 (Il2rg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    140924 (Il2rg)
   04061 Viral protein interaction with cytokine and cytokine receptor
    140924 (Il2rg)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    140924 (Il2rg)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    140924 (Il2rg)
   04659 Th17 cell differentiation
    140924 (Il2rg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    140924 (Il2rg)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    140924 (Il2rg)
   05340 Primary immunodeficiency
    140924 (Il2rg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    140924 (Il2rg)
   05162 Measles
    140924 (Il2rg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    140924 (Il2rg)
   04090 CD molecules [BR:rno04090]
    140924 (Il2rg)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL2 receptor family
   140924 (Il2rg)
CD molecules [BR:rno04090]
 Proteins
  140924 (Il2rg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind Interfer-bind IL4Ra_N
Motif
Other DBs
NCBI-GeneID: 140924
NCBI-ProteinID: NP_543165
RGD: 621466
Ensembl: ENSRNOG00000003954
Vega: OTTRNOG00000000601
UniProt: Q68FU6
Position
Xq22
AA seq 368 aa AA seqDB search
MLKPLLPSRSFLLLQLLLLRVGWSSKVLMSSGNEDTKSDLLLTSMDLKHLSVPTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTMHYRYKGSDNNTFQECSHYLFSKEITSGCQIQKE
DIQLYQTFVVQLQDPQKPQRRAEQKLNLQNLVIPWAPENLTLYNLSESQVELRWKSRYIE
RCLQYLVQYRSNRDRSWTEQIVDHEPRFSLPSVDEQKLYTFRVRSRFNPICGSTQQWSKW
SQPIHWGSHTAEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPRIPAIKNLEDLVT
EYHGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPPP
CYSLKPEA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaccattattgccatctagatccttcttactccttcagctgcttctgctgagg
gtagggtggagctccaaggtcctcatgtccagtgggaatgaagacaccaaatctgatctc
ttgctgacttctatggaccttaaacatctcagtgttcctactctgcccctcccagaggtt
caatgctttgtgttcaatgtcgagtatatgaattgcacttggaatagcagttctgagcct
cagccgaccaacctcactatgcactataggtacaagggatctgataataatacattccag
gagtgcagccactatctgttctcaaaagagattacttctggctgtcagatacaaaaagaa
gatatccagctctaccagacatttgttgtccagcttcaggacccccagaaaccccagagg
cgagccgaacagaagctaaacctacagaatcttgtgatcccatgggctccagagaatcta
acactttataacctgagtgaatctcaggtagaactgaggtggaaaagcagatacatagaa
cgctgtttacaatacttggtgcagtaccggagcaaccgagatcgaagctggacggaacaa
atagtggatcatgagcctagattctccctgcctagtgtggatgaacagaagctgtacaca
tttcgggttcggagccgctttaacccgatctgtggaagtactcaacagtggagtaaatgg
agccaaccaatccactgggggagccatactgcagaggagaatccttccttgtttgcactg
gaagctgtgcttatccctgttggcaccatggggttgattattaccctgatctttgtgtac
tgttggttggaacgaatgcctcgaattcccgccatcaagaatctagaggatctggttact
gaataccatgggaacttttcggcctggagtggtgtgtctaaagggctgactgagagtctg
cagccagactacagtgaacggttctgccacgtcagtgagattcccccgaaaggaggagcc
ctaggagaggggcctggaggctctccttgcagccttcatagcccttactggcctccccca
tgttattctctgaagcctgaagcctga

DBGET integrated database retrieval system