KEGG   Rattus norvegicus (rat): 170670
Entry
170670            CDS       T01003                                 

Gene name
Hadha, RGD1560655
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00062  Fatty acid elongation
rno00071  Fatty acid degradation
rno00280  Valine, leucine and isoleucine degradation
rno00310  Lysine degradation
rno00380  Tryptophan metabolism
rno00410  beta-Alanine metabolism
rno00640  Propanoate metabolism
rno00650  Butanoate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01212  Fatty acid metabolism
Module
rno_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
rno_M00085  Fatty acid elongation in mitochondria
rno_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    170670 (Hadha)
   00650 Butanoate metabolism
    170670 (Hadha)
  09103 Lipid metabolism
   00062 Fatty acid elongation
    170670 (Hadha)
   00071 Fatty acid degradation
    170670 (Hadha)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    170670 (Hadha)
   00310 Lysine degradation
    170670 (Hadha)
   00380 Tryptophan metabolism
    170670 (Hadha)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    170670 (Hadha)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     170670 (Hadha)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     170670 (Hadha)
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Other DBs
NCBI-GeneID: 170670
NCBI-ProteinID: NP_570839
RGD: 620512
Ensembl: ENSRNOG00000024629
UniProt: Q64428
Position
6q14
AA seq 763 aa
MVASRAIGSLSRFSAFRILRSRGCICHSFTTSSALLSRTHINYGVKGDVAVIRINSPNSK
VNTLNKEVQSEFVEVMNEIWANDQIRSAVLISSKPGCFVAGADINMLASCTTPQEAARIS
QEGQKMFEKLEKSPKPVVAAISGSCLGGGLELAIACQYRIATKDRKTVLGVPEVLLGILP
GAGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQLVDPLGPGIKSPEERTIEYL
EEVAVNFAKGLADRKVSAKQSKGLMEKLTSYAMTIPFVRQQVYKTVEEKVKKQTKGLYPA
PLKIIDAVKTGLEQGNDAGYLAESEKFGELALTKESKALMGLYNGQVLCKKNKFGAPQKT
VQQLAILGAGLMGAGIAQVSVDKGLKTLLKDTTVTGLGRGQQQVFKGLNDKVKKKALTSF
ERDSIFSNLIGQLDYKGFEKADMVIEAVFEDLAVKHKVLKEVESVTPEHCIFASNTSALP
INQIAAVSQRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAVGLKQGKVIIVVK
DGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDALTTGFGFPVGAATLADEVGIDVAQHVA
EDLGKAFGERFGGGSVELLKLMVSKGFLGRKSGKGFYIYQSGSKNKNLNSEIDNILVNLR
LPAKPEVSSDEDIQYRVITRFVNEAVLCLQEGILATPEEGDIGAVFGLGFPPCLGGPFRF
VDLYGAQKVVDRLRKYESAYGTQFTPCQLLRDLANNSSKKFYQ
NT seq 2292 nt   +upstreamnt  +downstreamnt
atggtggcgtcccgggcaattggcagtctcagtcgcttctctgccttcaggatcctgcgc
tccagaggctgcatttgccacagctttacaacttcttctgctttgctgtctagaacccat
attaattatggagtcaaaggggatgtggcagttattcggattaactcgcccaattcaaag
gtaaatacattgaataaagaagtacaatcagagttcgtagaagtaatgaacgaaatctgg
gccaacgaccaaatcaggagcgccgtccttatttcgtcaaagcctggctgctttgttgca
ggtgctgacatcaacatgctggcctcttgtacaacgccccaagaagcagcacgaatatca
caagaaggacagaaaatgtttgagaaacttgaaaagtcaccaaagcctgttgttgccgcc
atcagtggatcctgcttgggaggcggacttgagcttgccatagcatgtcaatacagaata
gcaacaaaagacagaaaaacagtattaggtgtccctgaagtgttgctgggaatcttacca
ggagccggaggtacccagaggctgcccaaaatggtgggtgtgcctgctgcttttgacatg
atgctgactggtaggaacattcgtgcagacagagcaaagaaaatgggactggttgaccag
ttggtggacccgctaggaccaggaataaaatctccagaggaaaggacaattgaataccta
gaagaagttgcagttaattttgccaaaggcctggctgacaggaaggtctctgcaaagcag
agcaaaggcctgatggaaaagctgacatcgtatgccatgactatcccatttgtcagacaa
caggtttacaaaacagtggaagaaaaagtgaagaagcagaccaaaggcctttaccctgca
cctttgaagataattgacgctgtgaagactggacttgagcaaggaaatgatgctggctat
cttgccgaatcagagaaatttggagagcttgcattgaccaaagaatcaaaagccctgatg
gggctttataatggccaggtcctgtgcaagaaaaataaatttggagcgccacagaagact
gttcagcagctagccatccttggcgcagggctgatgggggctggcattgcccaggtctct
gtggacaagggactgaaaactcttcttaaagacactacagtgacagggctgggccgggga
cagcaacaagtgttcaaaggactgaatgacaaggtaaagaagaaggcactcacatccttc
gaaagggactccatcttcagcaacctgatcgggcagctcgactacaagggcttcgagaag
gctgacatggtgattgaggctgtcttcgaggacctcgctgttaagcacaaagtgttaaag
gaagtggaaagcgtgactccagaacactgtatcttcgccagcaacacatctgctctccca
atcaatcaaattgctgctgtgagccaaaggcctgagaaggtgatcggcatgcactacttc
tctcctgtggacaagatgcagcttctagagatcatcacaactgacaaaacctccaaggac
accacagcgtctgccgtggccgtgggtctcaagcaggggaaggtcatcattgtggtcaag
gacggacctggcttctacaccaccaggtgtcttgctcccatgatgtcagaagtcataaga
atcctccaggaaggagttgaccctaagaagctggacgccttgaccacaggcttcggcttc
cctgtgggtgctgccaccctggcagatgaagtagggatagatgtagcacagcacgtagca
gaagatctaggcaaagccttcggggagcggtttggaggtggcagcgtagaactgctgaaa
ctgatggtctccaagggcttcttgggtcgcaagtctgggaagggcttctacatctatcag
tcgggctcaaagaataagaatttgaattctgaaatagataatatcttggtaaacctgagg
ctgcctgccaagcccgaggtctcctctgatgaagacatccagtaccgtgtgataacaagg
tttgtgaatgaggcagtcctgtgcctacaggaagggatcctagccacgcctgaagaggga
gacatcggagcagtctttgggcttggctttcccccttgtctcggagggcccttccgcttt
gtggatctgtatggtgctcagaaggtagtggaccggctccggaagtatgagtctgcctat
gggacacagtttaccccgtgtcagctactccgcgaccttgctaacaactctagcaagaag
ttctaccagtga

DBGET integrated database retrieval system