KEGG   Rattus norvegicus (rat): 170739
Entry
170739            CDS       T01003                                 

Gene name
Kcnh7
Definition
(RefSeq) potassium voltage-gated channel subfamily H member 7
  KO
K04910  potassium voltage-gated channel Eag-related subfamily H member 7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    170739 (Kcnh7)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   170739 (Kcnh7)
SSDB
Motif
Pfam: Ion_trans PAS_9 cNMP_binding Ion_trans_2 PAS_3 PAS PAS_8 PAS_4 ATG16
Other DBs
NCBI-GeneID: 170739
NCBI-ProteinID: NP_571987
RGD: 621112
Ensembl: ENSRNOG00000007528
UniProt: O54852
Position
3
AA seq 1195 aa
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNGSTFICNTHIIPVKNQEG
VAMMFIINFEYVTDEDNAASPERVNPILPVKSVNRKLFGFKFPGLRVLTYRKQSLPQEDP
DVVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSQCSPLVNISGPLDHSSP
KRQWDRLYPDMLQSSSQLTHSRSRESLCSIRRASSVHDIEGFNVHPKNIFRDRHASEDNG
RNVKGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSDVKTEKKNTSPPSSDKTIIA
PKVKERTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIY
TAIFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEE
VVSDPAKIAVHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARK
LDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGTQIGKRYN
DSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFG
NVSAIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVL
KGFPECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLT
ALYFLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQRED
LLEVLDMYPEFSDHFLTNLELTFNLRHESAKSQSINDSEGDTCKLRRRRLSFESEGDKDF
SKENSANDADDSTDTIRRYQSSKKHFEEKKSRSSSFISSIDDEQKPLFLGTVDSTPRMVK
ASRHHGEEAAPPSGRIHTDKRSHSCKDITDTHSWEREHARAQPEECSPSGLQRAAWGISE
TESDLTYGEVEQRLDLLQEQLNRLESQMTTDIQAILQLLQKQTTVVPPAYSMVTAGAEYQ
RPILRLLRTSHPRASIKTDRSFSPSSQCPEFLDLEKSKLKSKESLSSGKRLNTASEDNLT
SLLKQDSDASSELDPRQRKSYLHPIRHPSLPDSSLSTVGILGLHRHVSDPGLPGK
NT seq 3588 nt   +upstreamnt  +downstreamnt
atgcctgttcgcagggggcatgtggcaccgcaaaacaccttcctggggaccatcatacgg
aaatttgaagggcagaataaaaaatttatcattgcaaatgccagagtgcagaactgtgcc
atcatctactgcaatgatggcttctgtgagatgacaggtttctccaggccagatgtcatg
cagaagccatgcacctgcgactttctccatgggcctgagaccaagaggcatgatattgcc
cagattgcccaggcgctgttggggtcagaggagaggaaagtggaggtcacctactatcac
aagaatggttccacttttatttgtaacactcacataatcccagtaaagaaccaagagggt
gtggctatgatgttcatcattaactttgagtatgtgacagatgaagacaatgctgcctcc
ccagagagagtcaacccaatattgccagtcaaatctgtaaatcggaaactttttgggttc
aaatttcctggtctgagagttctaacatacagaaagcagtccttgccgcaggaagacccg
gacgtggtagtcattgattcttctaagcacagcgatgactctgtggctatgaagcacttt
aagtctcccacgaaagaaagctgcagtccctctgaagcagatgatacgaaggccttgata
cagcctagccagtgttctcccttagtgaacatatcaggacctctggaccattcctctccc
aaaaggcaatgggaccgcctctaccctgacatgctgcagtcaagttcccaactaacacac
tccaggtcaagggagagcctctgtagcatacggagagcatcttcagttcatgatatagaa
gggttcaatgtccaccccaagaacatatttagagatcgacatgccagtgaagacaatggt
cgaaatgtcaaaggacctttcaatcatatcaagtcaagcctgttgggatccacatcagat
tcaaacctcaacaaatacagcaccattaacaagatcccgcaactcactctgaacttttca
gatgtcaaaactgagaaaaagaatacttccccgccttcttcagacaaaactattattgca
cccaaggttaaagagaggacacacaacgtgacagagaaggtaactcaggttctttctttg
ggagcagatgtcttgccagaatacaagctgcagacgccacgcatcaacaaatttacaata
ttgcactacagccctttcaaagcagtgtgggattggctcattttactcctggtcatttat
actgctatattcaccccctactcggcagcctttctcctcaacgacagagaggagcagaaa
agacgagaatgtggctattcttgtagccctttgaatgtggtagacttgattgtggatatt
atgtttattatagacatcctaataaacttcagaacaacctatgtaaatcagaacgaagaa
gtggtaagtgatcctgccaaaatagcagtacactacttcaaaggctggttcctgattgac
atggtcgcagccatcccttttgacttgctgattttcggatcaggctctgatgagacaaca
acactaattggtcttttgaagactgcacgtctcctgcgtcttgtgcgtgtagccaggaaa
ctggaccgatactcagaatatggtgccgctgttctaatgctcttgatgtgcatatttgcc
ctgattgcccactggctggcttgcatctggtatgcgattgggaatgtagagaggccctat
ctgactgacaaaattggatggttggattccttaggaacacaaattgggaaacgttacaat
gacagtgactcgagttctggaccgtccattaaagacaaatacgtcacggcactttacttt
accttcagcagtctaaccagtgtaggatttggaaatgtgtctcctaacaccaattcggag
aaaatcttttccatttgtgtcatgttgattggctctctaatgtatgcgagcatttttggg
aatgtttctgcaattattcaaagactgtactcgggaactgccaggtaccacatgcagatg
ctgagagtgaaagagttcattcgcttccaccaaatccccaaccctctgaggcaacggctt
gaggagtatttccagcacgcatggacgtacactaacggcattgacatgaacatggtctta
aagggatttccggaatgtttacaagctgacatttgcctgcatctaaaccagactttgctc
caaaactgcaaagcctttcgaggagcaagtaaaggttgcctcagagctctggcaatgaag
ttcaaaaccacccatgcccctccaggagacaccctggttcactgtggggacgtcctaact
gcactgtacttcttatccagaggctccattgaaatcctcaaggatgacatagtggtagct
attctaggaaaaaatgatatctttggagaaatggttcatctttacgccaagcctggcaaa
tctaatgcagatgtgagagcgctcacgtattgtgacctgcataagattcagcgagaagac
ttattagaggtcttggatatgtatccggaattttctgatcactttctgacaaatctagaa
ctgactttcaacctgagacacgaaagtgcaaagtcccaatccataaatgattctgaaggg
gacacctgtaagcttcgaagaaggagattgtcctttgaaagcgaaggcgacaaagatttt
agcaaagaaaacagtgcaaatgacgctgacgattccacagatacaataagacgttatcag
agttccaagaagcacttcgaagagaagaaaagcagatcgtcttcctttatctcctccatc
gatgatgagcaaaagccactcttcctgggaacagtagattccactccaagaatggtgaaa
gcaagcaggcaccatggtgaagaagcagcgcccccctcaggaagaattcacacagataaa
aggagtcactcctgcaaagatatcactgacacacacagctgggaaagagagcatgcccgg
gctcagcctgaagaatgcagtccctccggacttcagagagctgcctggggcatctctgag
accgaaagcgacctcacctatggggaagtggagcagaggttagatttgcttcaagagcaa
cttaacagacttgaatcccaaatgacaacggacatccaggccatcttacagctcctgcag
aaacaaaccaccgtagtccctccagcctacagcatggtgaccgcaggagcagagtaccag
aggcccatcctccgtctgctgagaaccagtcaccctagagcatccattaagacagaccgg
agcttcagcccctcctcacaatgtcctgaatttctcgaccttgaaaagtccaaactcaaa
tccaaagaatcactgtcaagcggaaagcgcctgaacacggcttcagaagacaacttgact
tcacttttaaaacaagacagtgatgcatcgtcagagcttgacccgcggcaaagaaaatct
taccttcatcccatccggcatccgtctctgccagactcctccctaagcactgtagggatc
ttgggtctccataggcatgtttctgatcctggtcttccgggaaagtaa

DBGET integrated database retrieval system