KEGG   Rattus norvegicus (rat): 170820Help
Entry
170820            CDS       T01003                                 

Gene name
Prdm4, SC-1
Definition
(RefSeq) PR/SET domain 4
  KO
K12463  PR domain zinc finger protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    170820 (Prdm4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf_PR_Knuckle zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met zf-C2H2_jaz zf-H2C2_5 Mu-like_Com
Motif
Other DBs
NCBI-GeneID: 170820
NCBI-ProteinID: NP_579846
RGD: 619929
Ensembl: ENSRNOG00000004962
UniProt: Q9QZP2
Position
7q13
AA seq 798 aa AA seqDB search
MNDMNLSPVGMEQLSSSSVSNALPVSGSHLGLAASPSHSAIPAPGLPVAIPNLGPSLSSL
PSALSLMLPMGIGDRGVMCGLPERNYTLPPPPYPHLESSYFRTILPGILSYLADRPPPQY
IHPNSINVDGNTALSITNNPSALDPYQANGNVGLELGIVSIDSRSVNTHGAQSLHPNDGH
EVALDTTITMENVSRVTSPISTDGMAEELTMDGVTGEHSQIPNGSRSHEPLSVDSVSNNL
TADTVGHGGVIPIHGNGLELPVVMETDHIANRVNGISDSVLSDSIHTVAMSTNSVSVALS
TSHNFASLESVSLQEVGLSLEPVAVSSITQEVAMGTGHVDVSSDSLSFVPSSLQMEDSNS
NKENMATLFTIWCTLCDRAYPSDCPDHGPVTFVPDTPIESRARLSLPKQLVLRQSIVGTD
VGVWTAETIPVRTCFGPLIGQQSHSMEVAEWTDKAVSHVWKIYHNGVLEFCIITTDENEC
NWMMFVRKARNREEQNLVAYPHDGKIYFCTSQDIPPENELLFYYSRDYAQQIGVPEHPDV
HLCNCGKECSSYSEFKAHLTSHIHNHLPSQGHSSSHGPSHSKERKWKCSMCPQAFISPSK
LHVHFMGHMGMKPHKCDFCSKAFSDPSNLRTHLKIHTGQKNYRCTLCDKSFTQKAHLESH
MVIHTGEKNLKCDYCDKLFMRRQDLKQHVLIHTQERQIKCPKCDKLFLRTNHLKKHLNSH
EGRRDYVCEKCTKAYLTKYHLTRHLKACKEPASSSSAQDDEDEDGDSGEDGLPGSMTTEG
CRMSSAVYSADESLSAHK
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacatgaacttgagcccagtggggatggagcagctgtcttcatcctctgtgagc
aatgccctgccagtctcaggaagtcacctgggtctggctgcctctccctctcacagtgcc
atccctgccccaggacttccagtggcaattccaaacctcggtccctccctgagctctctg
ccttctgccttgtctctgatgctccccatgggcattggagatcgaggagtaatgtgtggg
ttacctgaaagaaactataccctacctccaccaccttaccctcacctagagagcagttac
ttcagaaccattctacctggcattttatcttatttagctgacagaccacctcctcagtat
atccaccccaactctataaatgttgatggaaatacagcattatctatcaccaacaaccct
tcggcactagatccctatcaggccaatggaaatgttggattagaactaggcattgtttca
atagactctcgctctgtaaacactcatggtgcccaaagtcttcatcctaatgatggccac
gaagtagcattggacacaacaatcactatggagaatgtctctagggttaccagcccaatc
tccacagacggaatggcagaggaacttacaatggatggagttacaggagaacattcccag
atcccaaatggctccagaagtcatgaacccctctctgtggattctgtgagcaacaacctt
acagctgacactgtaggacatggtggtgtgatacccattcatgggaatggtctggagctt
ccagtggtcatggagacagaccacattgcaaaccgggtcaatgggatatctgacagcgtc
ctcagtgattccatccacaccgtggccatgagcaccaactctgtaagcgtggcactttct
acctcacacaacttcgcctccctagaatctgtttccctccaggaagttggccttagccta
gagcctgtggctgtctcttccatcacccaggaagttgccatggggacaggtcatgtagat
gtatcctcagacagcttgtcttttgtaccatcttcactgcaaatggaagactccaattca
aacaaggaaaacatggcaaccttgtttacaatttggtgcacgctttgtgaccgagcatac
ccctcagattgccctgatcatggaccagtgacttttgttcctgatacaccaatagagagc
agagcaagactatccctcccgaagcagcttgttctccgccagtccattgtggggacagat
gttggcgtgtggactgcagagaccattcccgtgcggacttgcttcgggcctctaattggc
cagcagagtcactccatggaagtggcggagtggacagacaaggccgttagccacgtctgg
aagatataccacaatggcgtcctagaattctgcatcattacaaccgatgagaatgagtgt
aattggatgatgtttgtgcgcaaagccaggaaccgtgaagaacagaatttggtggcttat
ccccatgatggaaaaatctatttctgtacctcacaagacatccctcctgaaaacgagctg
cttttctattatagccgggattatgctcaacagataggtgttcctgaacaccccgatgtg
cacctctgtaactgtggcaaggagtgcagttcctattcagagttcaaagctcacctgacc
agccatatccacaatcatctccctagccagggccacagcagcagccatgggccaagccac
agcaaggaaaggaagtggaagtgctccatgtgcccccaggcctttatttctccttctaaa
ctccacgttcactttatgggtcatatgggcatgaagccccacaagtgtgatttttgtagc
aaggcttttagtgatccaagcaacctacggacacacctcaaaatacatacaggtcagaag
aattacaggtgtactttgtgtgacaagtctttcacgcagaaggctcacttggagtctcac
atggtcatccacacgggtgagaagaatctcaagtgtgattactgtgacaagctattcatg
cggagacaggacctcaagcagcatgtgctcatccacacacaagaacgccagatcaagtgt
ccgaagtgtgataaactgttcctgagaacaaaccacttgaagaagcatctcaactctcac
gagggaagacgagactatgtctgtgagaaatgcacaaaggcttacctaaccaagtaccac
ctcacccgccacctgaaggcctgcaaggagcccgcctccagctcctccgcccaggacgat
gaggacgaggacggggactcgggggaagacggtctcccaggctccatgacgacagagggc
tgcaggatgagcagtgctgtttactcagcagatgagtctctctccgcacataaataa

DBGET integrated database retrieval system