KEGG   Rattus norvegicus (rat): 170841Help
Entry
170841            CDS       T01003                                 

Gene name
Mutyh, Myh
Definition
(RefSeq) mutY DNA glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    170841 (Mutyh)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    170841 (Mutyh)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     170841 (Mutyh)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     170841 (Mutyh)
 Prokaryotic type
     170841 (Mutyh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX_4 HhH-GPD HHH EndIII_4Fe-2S
Motif
Other DBs
NCBI-GeneID: 170841
NCBI-ProteinID: NP_579850
RGD: 620045
Ensembl: ENSRNOG00000017887
UniProt: Q8R5G2
Position
5q35
AA seq 516 aa AA seqDB search
MKKLRASVRSHKKQPANHKRRGKCALSSSQAKPSGLDGLAKQKREELLKTPVSPYHLFSD
IADVTAFRRNLLSWYDQEKRDLPWRKRVKEETNLDRRAYAVWVSEVMLQQTQVATVIDYY
TRWMQKWPTLQDLASASLEEVNQLWSGLGYYSRGRRLQEGARKVVEELGGHVPRTAETLQ
QLLPGVGRYTAGAIASIAFDQVTGVVDGNVIRVLCRVRAIGADPTSSFVSHHLWDLAQQL
VDPARPGDFNQAAMELGATVCTPQRPLCNHCPVQSLCRAHQRVGQGRLSALPGSPDIEEC
ALNTRQCQLCLPSTNPWDPNMGVVNFPRKASRRPPREEYSATCVVEQPGATGGPLILLVQ
RPNSGLLAGLWEFPSVTLEPSGQHQHKALLQELQHWSAPLPTTPLQHLGEVIHVFSHIKL
TYQVYSLALEGQTPASTTLPGARWLTWEEFRNAAVSTAMKKVFRVYEEHRRGTCKGSKRP
QVCTPSSRKKPSRGQQVLDRFFQRHIPTHKPNSTTQ
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttacgagcatctgtaaggagtcacaagaagcaaccagccaaccacaagaga
aggggaaaatgtgctcttagcagcagccaggccaaaccttctggcctcgatggcctggcc
aagcagaagagagaggagttactgaagacccctgtctctccatatcacctcttcagtgac
atagccgatgtcacagctttccgaaggaacctgctcagctggtatgaccaagagaagcgt
gaccttccttggagaaaacgggtaaaggaggagaccaacttggacaggagagcctatgca
gtctgggtgtcagaggtcatgctgcagcagacccaagttgccacagtgatcgactattat
acccgatggatgcagaagtggccaacgctacaagacctggccagtgcttccctggaggag
gtgaaccagctctggtctggcctgggctactattctcgaggtcgtcggctccaagaagga
gctaggaaggtggtagaggagctaggaggccacgtaccacgtacagcagagaccctgcag
cagctcctgcctggggtggggcggtacacggctggagccatcgcttctattgcctttgac
caggtaaccggtgtggtggatgggaacgtcatacgggtgctgtgccgtgtccgcgccatt
ggtgctgatcccaccagctcctttgtctctcatcacctctgggacttagcccagcagctg
gtggacccagcccggcctggggatttcaaccaagcagccatggagctgggagccacagtg
tgtaccccacagcgccctctctgcaaccattgtcctgtgcagagtttatgccgggcacac
cagagggtgggacagggacggctctcagccttgccaggcagtcctgacatagaggagtgc
gctctcaacactagacagtgccagctttgcctcccttccacaaacccctgggaccccaac
atgggagtggtcaacttccctcgaaaggccagccgcagacctcccagggaggagtactct
gccacctgtgttgtagagcagcccggagccactgggggtcccctcatcctcctggtgcaa
aggcctaactcaggtctgctggcaggactgtgggagttcccgtctgtcaccttggagccc
tcaggacagcatcagcacaaagccctactgcaggagctgcagcactggtctgcacccctc
cccaccactcctctccagcacctgggggaggtgatccatgtcttctctcacatcaaactg
acgtatcaggtatacagtctggctctcgaaggacagaccccagcaagcaccacacttcct
ggcgctcgatggttgacctgggaggaattccgaaatgcagcggtgtctactgccatgaaa
aaggtgttccgcgtgtatgaggaacatcggcgagggacctgcaagggttccaaaaggccc
caggtgtgtactccatcaagccggaaaaaacccagccggggacagcaagtcctggatcgt
ttctttcagcgtcatatccccacacacaaacccaacagtactacccagtga

DBGET integrated database retrieval system