KEGG   Rattus norvegicus (rat): 170906
Entry
170906            CDS       T01003                                 

Gene name
Zdhhc7
Definition
(RefSeq) palmitoyltransferase ZDHHC7
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    170906 (Zdhhc7)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     170906 (Zdhhc7)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    170906 (Zdhhc7)
SSDB
Motif
Pfam: DHHC
Other DBs
NCBI-GeneID: 170906
NCBI-ProteinID: NP_596885
RGD: 620205
Ensembl: ENSRNOG00000017342
UniProt: Q923G5
Position
19
AA seq 308 aa
MQPSGHRLRDIEHHPLLTDNDNYDSASSSSSEADMADRVWFIRDGCGMVCAVMTWLLVVY
ADFVVTFVMLLPSKDFWYSVVNGVLFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMES
LQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTM
YIALSSIHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLEGLLFFTFTAVMFGT
QIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLQMRTR
KGGPEFSV
NT seq 927 nt   +upstreamnt  +downstreamnt
atgcagccgtcaggacacaggctccgggacattgagcaccatcctctcctgactgacaat
gacaattatgactctgcgtcctcctcgtcctccgaggctgacatggcagacagggtgtgg
ttcatccgagatggctgtggcatggtctgtgctgtcatgacatggcttctggtcgtctat
gcagactttgtggtgaccttcgtcatgctgctgccttccaaagacttctggtactccgtg
gtgaacggggtcctcttcaactgcttggcggtgctcgcgctgtcctcccacctaagaacc
atgctcactgacccgggggctgtccccaaaggcaacgccacgaaggagtacatggagagc
ttgcagctgaagccgggcgaggtgatctacaagtgccccaagtgttgctgcatcaagccg
gagcgtgcccaccactgcagtatctgcaagaggtgcattcgaaagatggaccaccactgc
ccgtgggtgaacaactgtgtgggagagaagaaccagcgcttcttcgtgctcttcaccatg
tacatagctctgtcttcaatccatgctctgattctctgcgggcttcagttcatctcttgc
gtccgagggcagtggacagagtgcagtgacttctctcctcccataactgtaatcctgttg
gtcttcctgtgccttgagggcctcctgttcttcactttcaccgcagtcatgttcggcacc
cagatccactcaatatgcaatgacgaaactgagatcgagaggctgaagagtgagaagcct
acgtgggagcgaaggctgcggtgggaagggatgaagtctgtcttcgggggccctccctcc
ctcctctggatgaacccctttgtgggcttccgattcaggcggctgcagatgaggaccagg
aagggaggccccgagttctctgtatga

DBGET integrated database retrieval system