KEGG   Rattus norvegicus (rat): 170907
Entry
170907            CDS       T01003                                 

Gene name
Serinc5, Tpo1
Definition
(RefSeq) serine incorporator 5
  KO
K24177  serine incorporator 4/5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    170907 (Serinc5)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    170907 (Serinc5)
SSDB
Motif
Pfam: Serinc DUF3021
Other DBs
NCBI-GeneID: 170907
NCBI-ProteinID: NP_596886
RGD: 621571
Ensembl: ENSRNOG00000024039
UniProt: Q63175 A0A140TAJ2
Position
2q12
AA seq 461 aa
MSARCCAGQLACCCGSAGCALCCGCCPKFRQSRSTRFMYLFYFTLVIIPCCVMMSPSVMK
QMTEHIPFFEDFCKGIKAGDTCENLVGYSAVYRVCFGMACFFFVFCVLTFKVNNSKSCRA
SIHNGFWFFKLLLLGAMCSGAFFIPDQETFLNVWRYVGAVGSFFFICIQLLLIVEFAHKW
NKNWTAGTVRNKLWYASLSLATLIMYSIAVGGLALMAVFYTQWDDCMDNKILLGVHGGLC
VLISLAAISPCVQNRQPHSGLLQPGLISCYVTYLTFSALTSKPEKVVKDEHGKNVTICVP
DFGQDFRRDESMVTWLGTLLLVVCISYSCLTSTTRSSSDALQRRYGAPELEVARCCFCFG
PDGEDTEEQQNVKEGPRVIYDEKKGTVYSYSYFHFVLLLASLYVMMTLTSWFHYENATIE
TFFVGSWSIFWVKMASCWMCVLLYLWTLVAPLCCPSRQFSV
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtctgcccggtgctgtgctggccagttggcctgctgctgcggatctgctggttgtgcc
ctctgctgtggctgctgccctaagttccggcaatctcggagcacccgcttcatgtattta
ttctacttcaccctggtcatcatcccctgctgcgtgatgatgtcaccctctgtgatgaag
cagatgacggagcacattcccttttttgaagacttctgtaaaggcatcaaagcgggcgac
acctgtgagaacctggtgggctattccgcggtgtacagagtctgctttggaatggcttgt
ttcttctttgtgttttgtgtgctgaccttcaaagtcaacaacagcaaaagttgtcgggcc
tccattcacaacggcttttggttctttaaattgctgctgttaggggccatgtgttcagga
gcattcttcattccagatcaggagacctttctgaatgtctggcgctatgtgggagctgtg
gggagcttcttcttcatttgtatccagctcctcctgattgtggagtttgcacataaatgg
aacaagaactggactgcaggcaccgtccgtaataagctgtggtacgcctccctgtcgctg
gcgacactcatcatgtattccattgccgttggcggcttggccttgatggcagtgttctac
acacagtgggatgactgcatggacaacaagattctcctgggagtgcacggtggcctatgc
gtgctaatctctctggcagccatctcaccctgcgtccagaatcgacagccacactctggg
ctgctgcagccagggctcataagctgctatgtcacctacctcaccttctcagcactgacc
agcaagcccgaaaaagtagtcaaagatgaacacgggaagaatgtcaccatatgtgtgcct
gacttcgggcaagactttcgtcgagatgaaagcatggtgacctggctgggcacccttctc
ttagttgtgtgcatctcatattcatgtttgacatcgacgacgaggtcgagctcggatgcc
ctgcagcggcgatacggagctcctgagctggaggtggcccggtgctgtttctgcttcggt
ccagatggggaagacacggaagagcagcagaatgtcaaggagggacccagggtcatttac
gatgagaagaaaggcaccgtctacagctactcctatttccactttgtcttgctcctggct
tccctctacgtgatgatgactttgaccagctggttccactatgaaaacgccaccattgag
accttcttcgttgggagctggtccatcttctgggtcaagatggcctcctgttggatgtgt
gtgctgctgtacctgtggaccctggtggctcccctttgctgtccttccaggcagttctct
gtctga

DBGET integrated database retrieval system