KEGG   Rattus norvegicus (rat): 170916
Entry
170916            CDS       T01003                                 

Gene name
Lonp1, Lon, Prss15
Definition
(RefSeq) lon peptidase 1, mitochondrial
  KO
K08675  ATP-dependent Lon protease [EC:3.4.21.53]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    170916 (Lonp1)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    170916 (Lonp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.53  endopeptidase La
     170916 (Lonp1)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S16: lon protease family
   170916 (Lonp1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    170916 (Lonp1)
SSDB
Motif
Pfam: Lon_C LON_substr_bdg AAA AAA_5 AAA_2 ChlI RuvB_N AAA_16 AAA_PrkA AAA_14 AAA_22 RNA_helicase AAA_33 TsaE NB-ARC NACHT AAA_18 RsgA_GTPase Viral_helicase1 NTPase_1 LXG AAA_23 Torsin AAA_3
Other DBs
NCBI-GeneID: 170916
NCBI-ProteinID: NP_596895
RGD: 621598
Ensembl: ENSRNOG00000046502
UniProt: Q924S5
Position
9q12
AA seq 950 aa
MAASTGYVRLWAAARCWVLRRPLLAVTGGRVPSASGSWLRRGCRVCDTSTPWGGRVPMGG
GQWRGLWDAGSRGGSDETSEGGVEDGATASSGEGPVVTALAPMTVPDVFPHLPLIAISRN
PVFPRFIKIVEVKNKKLVELLRRKVRLAQPYVGVFLKRDDNNESDVVESLDEIYHTGTFA
QIHEMQDLGDKLRMIVTGHRRIHISRQLEVEPEGLEPEAENKQKSRRKLKRGKKEVGDEL
GAKPQLEMVTEATSDTSKEVLMVEVENVAHEDFQVTEEVKALTAEIVKTIRDIIALNPLY
RESVLQMMQAGQRVVDNPIYLSDMGAALTGAESHELQDVLEETNILKRLYKALSLLKKEF
ELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVV
PKHVMDVVDEELSKLALLDNHSSEFNVTRNYLDWLTSIPWGRQSDENLDLARAQSVLEED
HYGMEDVKKRVLEFIAVSQLRGSTQGKILCFHGPPGVGKTSIARSIARALGREYFRFSVG
GMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLVLIDEVDKIGRGYQGDPSSALLEL
LDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIA
ERYLVPQARTLCGLDESKAQLSATVLTLLIKQYCRESGVRNLQKQVEKVLRKAAYKIVSG
EAQTVHVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQPS
GSKEDKDGSLEVTGQLGDVMKESARIAYTFARAFLMEQDPENDFLVTSHIHLHVPEGATP
KDGPSAGCTIVTALLSLALGQPVLQNLAMTGEVSLTGKVLPVGGIKEKTIAAKRAGVTCI
ILPAENRKDFSDLAPFITEGLEVHFVEHYRDIFRIAFPLREHQEALAVER
NT seq 2853 nt   +upstreamnt  +downstreamnt
atggcggcaagcacaggttacgtgcggctgtgggctgctgcgcggtgctgggttctgcgg
cgtccgctcttggctgtcaccggaggccgagtcccgagtgcgtccgggtcctggctgcgc
cgaggatgtcgggtctgcgacacgtcaactccctggggcggccgcgttcctatgggcggg
ggccagtggcgggggctgtgggacgcggggagccgcggtggcagcgacgagacctccgag
ggcggcgtggaggacggggccacggcgagcagcggggaaggcccggtcgtcacggccctc
gcgcctatgaccgtcccggatgtgtttcctcacctgccgctcatcgccatctcccgcaac
ccggtgttcccgcgctttatcaagatcgtggaggttaaaaataagaagttggttgagctg
ctgagaaggaaagtccgcctggcacagccgtatgttggcgtcttcttaaagagagatgat
aacaatgagtcagacgtggtggagagcctggatgagatctaccatacgggaacgttcgct
cagattcatgagatgcaggacctcggagacaagttgcgcatgatcgttacaggccacaga
aggattcacatcagccggcagctggaggtggaaccagaggggctggagccagaggcagag
aacaaacaaaagtccaggaggaagctgaagcgaggcaagaaagaggtcggggatgagctg
ggtgccaagccccagctggagatggtgactgaggctaccagtgacacatccaaagaggtg
ctcatggtggaggttgagaatgtagcccatgaagactttcaggtcacagaggaagtgaag
gccctgactgcagagatcgtgaagaccattcgggatatcatcgccctgaaccctctgtac
agagagtccgtgctgcagatgatgcaggcaggccagcgtgtggtggacaaccccatctac
ttgagcgacatgggtgccgcactcactggggctgagtcccatgagctgcaagatgtgctg
gaagaaacaaacatccttaagcggctctataaggccctgtctcttttgaagaaggagttc
gagttgagcaagcttcaacagcgcctggggcgtgaggtggaggagaagatcaagcagacg
cacaggaagtacctgctgcaggagcagctaaagatcatcaagaaagagttgggactagag
aaggatgataaagatgccattgaggagaagttccgggaacgcttaaaggagcttgtggtt
cccaagcatgtgatggacgtggtagatgaggagctgagcaagctggccctactggacaac
cactcctctgaattcaatgtcactcgcaactacctggactggctgacgtccatcccatgg
ggccggcagagcgatgagaacttagacctggctcgggcccagtcggtgctggaggaggac
cactatggcatggaggatgtgaagaagcgagtcttggagttcattgcagtcagccagctc
cgaggctccacacagggcaagatcctctgcttccacggcccaccaggtgtgggcaagacc
agcattgcacgctccattgcccgtgcccttggccgtgaatacttccgctttagtgttggt
ggcatgacagatgtggcagaaatcaaggggcacaggcgtacctatgtgggggccatgcct
gggaagattatccagtgtctgaagaaaaccaagacagagaacccattagtgctgattgat
gaggtggataagattggccgaggctaccaaggggacccgtcatcagcactgttggagttg
ttggaccctgagcagaatgccaacttcctggaccactacctggatgtgccagtggacctg
tccaaggtgctattcatctgcacagccaacgtcactgacactataccggagccactaagg
gatcgcatggagatgatcaatgtgtcaggctatgtagcacaggagaagctggccattgca
gagcggtacctggtgccacaggcccgcaccctgtgtggcctagacgagagcaaggcccaa
ctgtcagcgacagtgctcactctactcatcaaacagtactgcagggaaagtggtgtgcgc
aacctgcagaagcaggtggagaaggtgctgcgcaaggctgcatacaagattgtaagtgga
gaggcccagacagtgcacgtgacacctgagaacctgcaagactttgtagggaagccagtg
ttcacagtggagcgcatgtatgatgtcacgcctcctggtgtggtcatgggtttggcctgg
actgccatgggaggctccacattgttcgtggagacatctttaaggaggccccagcctagt
ggcagcaaggaggacaaggatggcagcctagaggtgacaggtcagctaggagatgtcatg
aaagagagtgcccgcatagcctacacctttgcccgtgccttcctgatggagcaggaccct
gaaaatgactttctggtcacatcccacatccacctgcatgtgcctgagggcgctaccccc
aaggatggccctagtgcaggttgcaccattgtcactgcattgctgtccctagctctgggg
cagccagtgttgcagaacctggccatgactggggaagtctccctcactggtaaagtgttg
cctgtgggtggcatcaaggagaagaccattgcggctaagcgtgcgggagtgacctgcatc
attttgcctgctgagaacaggaaggacttctcagacttggctcccttcatcacagagggc
ctggaggttcacttcgtggaacactaccgcgacatcttccgaattgccttccccctgcga
gagcaccaggaagcactggctgtggaaagatga

DBGET integrated database retrieval system