KEGG   Rattus norvegicus (rat): 171049
Entry
171049            CDS       T01003                                 

Gene name
Folr1, Fbp1
Definition
(RefSeq) folate receptor 1
  KO
K13649  folate receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01523  Antifolate resistance
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    171049 (Folr1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    171049 (Folr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    171049 (Folr1)
   04147 Exosome [BR:rno04147]
    171049 (Folr1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    171049 (Folr1)
Transporters [BR:rno02000]
 Other transporters
  Others
   171049 (Folr1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   171049 (Folr1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Receptors
  171049 (Folr1)
SSDB
Motif
Pfam: Folate_rec
Other DBs
NCBI-GeneID: 171049
NCBI-ProteinID: NP_598211
RGD: 71032
Ensembl: ENSRNOG00000019902
UniProt: G3V8M6
Position
1q32
AA seq 255 aa
MAHLMAGQWLLLLMWMAECAQSRATRARTELLNVCMDAKHHKEKPGPEDKLHDQCSPWKT
NACCSTNTSQEAHKDISYLYRFNWNHCGTMTPECKRHFIQDTCLYECSPNLGPWIQQVDQ
SWRKERILDVPLCKEDCVLWWEDCKSSFTCKSNWHKGWNWTSGHNECPVGASCHPFTFYF
PTPAVLCEKIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEVMSGAGLREAW
LLVCSLSLVLFWVLS
NT seq 768 nt   +upstreamnt  +downstreamnt
atggctcacctgatggctgggcagtggttgctcctgctgatgtggatggccgaatgtgcc
cagtccagagctactcgggccaggaccgaacttctcaatgtctgcatggatgccaagcac
cacaaagaaaagccaggcccagaggacaagttacacgaccagtgcagcccctggaagacg
aatgcctgctgctccaccaacacaagccaggaagcacataaggacatttcctacctgtac
cgattcaactggaatcactgtggaactatgaccccggagtgcaaacgtcactttatccaa
gacacctgcctctatgagtgttccccgaacttgggaccctggatccagcaggtggaccag
agctggcgcaaagagcggatccttgatgttcccctgtgcaaagaagactgtgtgctgtgg
tgggaggactgcaagagctcttttacctgcaagagcaactggcacaagggatggaactgg
acctcggggcataatgagtgccctgtgggagcctcctgccatcccttcactttctacttc
cctacacctgctgttctgtgtgagaaaatctggagtcactcctacaagctcagcaactac
agccgagggagcggccgctgcatccagatgtggttcgacccagcccaaggcaaccccaac
gaggaagtggcgaggttctatgccgaggtcatgagtggagctgggcttcgcgaggcctgg
ctgctggtgtgcagcctgtccttagtgctgttctgggtgctcagctga

DBGET integrated database retrieval system