KEGG   Rattus norvegicus (rat): 171079
Entry
171079            CDS       T01003                                 

Gene name
B3galt4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K00715  ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00604  Glycosphingolipid biosynthesis - ganglio series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    171079 (B3galt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    171079 (B3galt4)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     171079 (B3galt4)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Glycolipid
   171079 (B3galt4)
SSDB
Motif
Pfam: Galactosyl_T Fringe
Other DBs
NCBI-GeneID: 171079
NCBI-ProteinID: NP_598237
RGD: 620328
Ensembl: ENSRNOG00000000471
Vega: OTTRNOG00000001941
UniProt: Q6MGC2
Position
20
AA seq 371 aa
MPLSLFRRLLLAVLLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPN
PQACGGSGPPPFLLILVCTAPEHLNQRNAIRGSWGAIREARGFRVQTLFLLGEPMGQQFA
DLASESAAQGDVLQASFQDSYRNLTLKTLTGLNWVNKYCPMARYILKTDDDVYVNVPELV
SELIQRGGPSEQWQKGKEPQEETTAVHKEHKGQAVPLLYLGRVHWRVRPTRTPESRHHVS
EELWPENWGPFPPYASGTGYVLSISAVQLILKVASRAPYLPLEDVFVGVSARRGGLAPTH
CVKLAGATHYPLDRCCYGKFLLTSHKVDPWKMQEAWKLVRGLNGRRTEPFCSWLQGFLGT
LRCRFIAWLNS
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgcccctcagcctcttccggcgcctccttctggcggtcctactactggtgatcatctgg
acactgtttggaccatcgggtttgggggaggagctgctgagcctgtccctggcgtccctt
ctgccagccccagcctcgccaggaccacccctggccctgccccgcctcttgattcctaac
ccccaggcctgtggtggctccggaccccctcctttcttgctcatcctggtgtgtacggcc
ccggagcacctgaaccagagaaacgccattcggggatcttggggcgccattcgcgaggcc
cgcggtttcagggtgcagacgctcttcctcctgggagaacctatgggacagcagtttgct
gacctggcctcagagtcagcagcacagggggatgtcttgcaggcctccttccaggattcc
taccgcaacctcaccctcaagaccctcaccggactgaactgggtgaacaaatactgtcct
atggcccggtacatcctcaagacagatgatgacgtgtatgtcaatgtcccagagctggtg
tcagaactgatacagagaggggggccttcagagcaatggcagaagggcaaagagccacag
gaagagacaacagctgtccacaaagagcacaaaggccaggcagtgccccttctgtattta
ggccgggtgcactggagggtgaggcccactcgaacaccagagtcccggcatcacgtgtca
gaagaactgtggccagaaaactggggtcctttcccaccctacgcctctggcacggggtat
gtattgtctatctctgctgtgcagctcattctgaaggtggccagccgggccccatatcta
cctctggaggatgtctttgtgggagtaagcgcaaggcgagggggccttgcccccacacac
tgtgtcaagttggctggtgctacccactacccactggataggtgctgttacgggaagttc
ctgctgacgtcccacaaggtggatccttggaaaatgcaggaagcctggaagctggtgaga
ggactgaatgggagaaggactgagcccttttgttcctggctccagggatttctgggtacc
ttgaggtgccggttcatagcctggctcaatagttga

DBGET integrated database retrieval system