KEGG   Rattus norvegicus (rat): 171093
Entry
171093            CDS       T01003                                 

Gene name
Shank2, CortBP1, ProSAP1, Spank-3
Definition
(RefSeq) SH3 and multiple ankyrin repeat domains 2
  KO
K15009  SH3 and multiple ankyrin repeat domains protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    171093 (Shank2)
SSDB
Motif
Pfam: SAM_1 SAM_2 SH3_2 PDZ_6 SH3_9 PDZ SH3_1 SAM_4 SAM_PNT
Other DBs
NCBI-GeneID: 171093
NCBI-ProteinID: NP_597685
RGD: 628772
Ensembl: ENSRNOG00000050206
Vega: OTTRNOG00000002182
UniProt: Q9QX74
Structure
PDB: 
6CPJ

Position
1q42
AA seq 1470 aa
MKSLLNAFTKKEVPFREAPAYSNRRRRPPNTLAAPRVLLRSNSDNNLNAGAPEWAVCSAA
TSHRSLSPQLLQQTPSKPDGATKSLGSYAPGPRSRSPSLNRLGGAGEDGKRPQPPHWHVG
SPFTPGANKDSLSTFEYPGPRRKLYSAVPGRLFVAIKPYQPQVDGEIPLHRGDRVKVLSI
GEGGFWEGSARGHIGWFPAECVEEVQCKPRDSQAETRADRSKKLFRHYTVGSYDSFDAAS
DCIIEDKTVVLQKKDNEGFGFVLRGAKADTPIEEFTPTPAFPALQYLESVDEGGVAWQAG
LRTGDFLIEVNNENVVKVGHRQVVNMIRQGGNHLVLKVVTVTRNLDPDDTARKKAPPPPK
RAPTTALTLRSKSMTAELEELVDKASVRKKKDKPEEIVPASKPSRTAENVAIESRVATIK
QRPTSRCFPAASDVNSVYERQGIAVMTPTVPGSPKGPFLGLPRGTMRRQKSIDSRIFLSG
ITEEERQFLAPPMLKFTRSLSMPDTSEDIPPPPQSVPPSPPPPSPTTYNCPRSPTPRVYG
TIKPAFNQNPVAKVPPATRSDTVATMMREKGMFYRRELDRFSLDSEDVYSRSPAPQAAFR
TKRGQMPENPYSEVGKIASKAVYVPAKPARRKGMLVKQSNVEDSPEKTCSIPIPTIIVKE
PSTSSSGKSSQGSSMEIDPQATEPGQLRPDDSLTVSSPFAAAIAGAVRDREKRLEARRNS
PAFLSTDLGDEDVGLGPPAPRMQPSKFPEEGGFGDEDETEQPLLPTPGAAPRELENHFLG
GGEAGAQGEAGGPLSSTSKAKGPESGPAAALKSSSPASPENYVHPLTGRLLDPSSPLALA
LSARDRAMQESQQGHKGEAPKADLNKPLYIDTKMRPSVESGFPPVTRQNTRGPLRRQETE
NKYETDLSKDRRADDKKNMLINIVDTAQQKSAGLLMVHTVDIPVAGPPLEEEEDREDGDT
KPDHSPSTVPEGVPKTEGALQISAAPEPAAAPGRTIVAAGSVEEAVILPFRIPPPPLASV
DLDEDFLFTEPLPPPLEFANSFDIPDDRAASVPALADLVKQKKSDTPQPPSLNSSQPANS
TDSKKPAGISNCLPSSFLPPPESFDAVTDSGIEEVDSRSSSDHHLETTSTISTVSSISTL
SSEGGESMDTCTVYADGQAFVVDKPPVPPKPKMKPIVHKSNALYQDTLPEEDTDGFVIPP
PAPPPPPGSAQAGVAKVIQPRTSKLWGDVTEVKSPILSGPKANVISELNSILQQMNRGKS
VKPGEGLELPVGAKSANLAPRSPEVMSTVSGTRSTTVTFTVRPGTSQPITLQSRPPDYES
RTSGPRRAPSPVVSPTELSKEILPTPPSAAAASPSPTLSDVFSLPSQSPAGDLFGLNPAG
RSRSPSPSILQQPISNKPFTTKPVHLWTKPDVADWLESLNLGEHKETFMDNEIDGSHLPN
LQKEDLIDLGVTRVGHRMNIERALKQLLDR
NT seq 4413 nt   +upstreamnt  +downstreamnt
atgaagtctttgttaaatgccttcaccaagaaggaagtgcccttccgagaggccccagct
tattccaaccgcaggcggcggccccccaacacattggctgcccccagagttcttctgcgt
tccaatagcgacaacaacctcaatgccggtgcgcctgaatgggctgtctgctctgcagcc
acctcccaccgaagcctctcaccccagctgctgcagcagacacccagcaaacctgatgga
gccacaaagagccttggaagctacgcccctgggccccgcagccgctctccctcactcaac
aggctgggtggcgctggtgaggatggcaagaggccacagccgccacattggcatgtgggg
tcgcccttcactcctggtgccaacaaggactccctctcgacctttgagtacccagggccc
cggaggaagctgtatagtgcggtgcctgggagactcttcgtcgccatcaagccataccaa
ccccaagtcgacggcgagatcccccttcaccgaggcgacagggtcaaagttctgagcatc
ggcgagggcggcttctgggaaggcagcgcccgtggccacatcgggtggttcccagctgag
tgtgtggaggaggtacaatgtaagccccgggacagccaagcagaaacccgtgcggaccgc
agcaagaagctctttcggcattacacagtgggctcctatgacagctttgatgctgccagt
gactgcattattgaggacaagacggtggtcctgcagaagaaagacaacgagggctttgga
tttgtgctccgaggggcaaaagctgatacccccattgaggaattcacacccacgccggca
tttccagccctgcagtacctggagtccgtggatgaaggaggggtggcatggcaagccgga
ctaaggaccggggacttcttgattgaggttaacaatgaaaatgtcgtcaaggtgggccac
aggcaggtggtgaacatgatccgccagggagggaatcacctcgtccttaaggtcgtcacg
gtgaccaggaatctagaccctgatgatacagccagaaagaaagctcccccacctccaaag
cgggctccgaccacggccctcaccctgcgttccaagtccatgacagcggaattggaggaa
ctcgtggataaagcctcagtccggaagaagaaggataaaccggaagagatagtcccagcc
tccaagccctccaggactgcagagaacgtggccatagaatccagggtggcaaccatcaag
cagcggcccacaagccggtgctttccagctgcctctgatgtgaactccgtgtacgagcgc
caagggattgctgtaatgacgcccacggtccctgggagcccgaaaggcccatttctgggc
ctccctcgaggtacgatgcgaaggcagaaatcgatagacagcagaatctttctatcaggg
ataacagaggaagagcggcagtttctggctcccccaatgctgaagttcacccgaagcttg
tccatgccagacacttctgaggacatcccccctccgccacagtctgtgcccccctctccc
cctccaccttcccccaccacatacaactgtcccaggtccccgactccaagagtctatggg
acaattaagcctgcgttcaaccagaaccccgtcgccaaggtgcccccagccaccaggtct
gacactgtggccaccatgatgcgggaaaaggggatgttctacaggagagagctggaccgc
ttttccctggactcagaagacgtctacagccgcagccccgccccacaggctgccttccgc
accaagcggggacagatgcctgagaacccgtactcggaggtgggaaagatagccagcaag
gccgtctatgtccctgccaagccagccaggcggaagggcatgctggtaaagcagtccaac
gtggaggacagccctgagaagacgtgctccatccccatcccaaccatcatagtcaaggaa
ccctccaccagcagcagcggcaagagcagccaggggagcagcatggagatcgacccccag
gccactgagcccggccagctgcggccagatgacagcctcaccgtcagcagccccttcgcg
gcagccatcgctggggccgtgcgtgaccgggagaagcgtctggaagccaggaggaattcc
ccggccttcctctccaccgacctgggagatgaggacgtgggtctggggcctcctgctccc
cggatgcagccctccaagtttcccgaggagggtgggtttggtgatgaggatgaaacggaa
cagccgctattgcctacccctggagcagcgcccagggagctggagaaccacttcctaggt
ggtggtgaggctggtgctcagggggaggctgggggacccctgagttccacatccaaagcc
aaggggcctgaaagtggcccagcagccgccctcaagagcagcagcccagccagccctgag
aattacgtgcacccactcacggggcggctgctcgaccccagctccccgctggccctggca
ctgtccgccagggaccgagccatgcaggagtcccagcaaggacacaagggggaggccccc
aaggccgaccttaacaagcctctctacatcgataccaaaatgcggcccagtgtggagtcc
ggctttccaccggtcaccagacagaacaccaggggtcccctgcgaaggcaggagacagag
aacaagtatgagacggacctgagcaaggaccggagggctgacgacaagaagaacatgctg
atcaacatcgtggacactgcccagcagaagtcagccggcctactgatggtgcacacagtg
gacattcccgtggcggggccacccctggaggaagaggaggacagagaggatggggataca
aagccagaccactcaccctccacagtgccagaaggcgttcccaaaaccgaaggtgcttta
cagatctccgctgccccggagcccgccgctgcgcccggcaggaccatcgtggcagcgggc
tccgtggaagaggcggtaattctgccattccgcatcccccctccccctctggcgtccgtg
gacttggatgaggactttcttttcacagaaccattgcctcctcccctggaattcgccaat
agttttgatatccccgacgaccgggcagcttcagttcccgctctggctgacctggtcaag
cagaagaaaagtgacacccctcagcccccttcgttgaactccagccaaccagccaactct
acagacagtaagaagccagccggcatctcaaactgtctgccctcctcattcctgccaccc
cccgaaagctttgacgcggtcaccgactcggggatcgaggaggtggacagccggagtagc
agcgaccaccacctggagacaaccagcaccatctccacagtgtccagcatctccacgctg
tcttcagagggcggggagagcatggatacttgcacagtctatgcagacgggcaagccttt
gtggttgacaagcccccagtacctccaaagccaaaaatgaagcccatcgttcacaaaagc
aacgcactttaccaagacacgctcccagaagaggacacagatggctttgtgatcccccca
cctgcacccccgcccccgcccggcagtgcccaggccggtgtggcgaaggtcatccagcca
aggacctccaagttgtggggtgatgttacagaggtcaaaagcccaattctctcaggccca
aaggcaaatgtcattagtgagttaaactccattctgcagcagatgaacagggggaaatcg
gtcaagcctggggaagggctggagctgcccgtgggagccaagtcagctaacctcgctcca
agaagcccggaggtcatgagcactgtctcaggtacacggagcacgacggtcaccttcact
gtccgccccggaacctcccagcccatcaccctacagagccggccccctgactatgaaagc
aggacctcaggaccgagacgtgccccaagccctgtggtttcgccaacggaattgagcaaa
gagattctgcccacccctccgtctgctgcagcagcctctccctcccccacactctcagat
gtctttagccttccaagccagtcccctgcaggggacctctttggcttgaacccagcagga
cgcagcaggtcaccatctccttcaatattgcaacagccaatctcaaataagccttttaca
actaagcctgtccacctgtggacgaaaccagatgtggcagactggctggaaagtctgaac
ttgggtgaacacaaggagacgttcatggacaatgagattgacggcagccatctgccaaac
ctccagaaggaagacttgatagatcttggggtgactcgagttgggcacaggatgaacata
gaaagggctttgaaacagctgctggacagataa

DBGET integrated database retrieval system