KEGG   Rattus norvegicus (rat): 171100
Entry
171100            CDS       T01003                                 

Gene name
Angptl2
Definition
(RefSeq) angiopoietin-like 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Fibrinogen_C zf-C4H2 Spc29 Fer4_NifH
Other DBs
NCBI-GeneID: 171100
NCBI-ProteinID: NP_598253
RGD: 620004
Ensembl: ENSRNOG00000016678
UniProt: Q9JJ03
Position
3p11
AA seq 493 aa
MRPLCMTYWWLGLLATVGAVTGPEADVEGAEDGSQREYIYLNRYKRAGESPDKCTYTFIV
PQQRVTGAICVNSKEPEVHLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEV
KLVRKESRNMNSRVTQLYMQLLHEIIRKRDNALELSQLENRILNQTADMLQLVSKYKDLE
HKFQHLDMLAHNQSEVIAQLEEHCQRVPAARPVPQPPPATPPRVYQPPTYNRIINQISTN
EIQSDQNLKVLPPSLPTMPALTSLPSSTDKPSGPWRDCLQALEDGHSTSSIYLVKPENTN
RLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQ
GNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLD
RDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKK
VVMMIRPNPNTFH
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaggccactgtgtatgacttactggtggcttggactgctggccaccgtgggagctgtt
acaggcccagaggctgatgttgagggcgcagaggatggttcgcagagagagtacatttac
ctcaacaggtacaagagggcaggtgagtccccagacaagtgcacctacactttcattgtg
ccccagcagcgggtcacaggtgccatttgtgtcaactccaaagagcccgaggtgcacctg
gagaaccgtgtgcacaagcaggagctggagctgctcaacaatgagctgcttaagcagaag
cggcagatcgagacgctgcagcagctggtagaggtagatggcggcatcgtgagcgaggtg
aagctcgtgcgcaaggagagccgcaacatgaactctcgggtcacacagctgtacatgcag
cttctacacgagatcattcgcaagcgagacaatgcgctggagctttcccagctggagaac
aggatcctgaaccagacagctgacatgctgcagctggtgagcaagtacaaggacctggag
cacaagttccagcacctggatatgctggcacacaaccaatcagaggtcattgcccagctt
gaagagcactgccaacgtgtacctgcagccaggcctgtgccccagccacccccagccacg
ccacctcgggtctaccagccaccaacctacaaccgcatcatcaaccagatctccactaat
gagatccagagtgaccagaatctgaaggtgctgccaccctccctgcccaccatgcctgcc
cttaccagtctcccatcttccactgataagccatcaggtccatggagagattgtctacag
gccctggaggatggtcacagcaccagctccatctacctggtgaagccggagaataccaac
cgccttatgcaggtgtggtgcgaccagagacatgaccctgggggttggactgtcatccag
agacgcctggatggctctgtcaacttcttcaggaactgggagacctataagcaagggttt
gggaacatcgacggcgaatactggctgggcctggagaacatctactggctgacgaaccaa
ggcaactacaaattgcttgtaaccatggaggactggtctggccgcaaagtctttgcagag
tatgctagcttccgactggagccagaaagcgagtactataagctgcggctggggcgttat
cacggcaacgcaggcgactcctttacctggcacaacggcaaacagttcaccaccctggac
agggaccatgatgtctacacaggaaactgtgcccactatcagaagggaggatggtggtac
aatgcctgtgctcactccaacctcaatggggtctggtaccgtgggggccattaccggagc
cgataccaggatggggtctactgggctgagttccgaggaggatcttactcactcaagaag
gtggtgatgatgattcggcccaaccccaacactttccattaa

DBGET integrated database retrieval system