KEGG   Rattus norvegicus (rat): 171333Help
Entry
171333            CDS       T01003                                 

Gene name
Il12rb1, Il12rb
Definition
(RefSeq) interleukin 12 receptor subunit beta 1
  KO
K05063  interleukin 12 receptor beta-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  Jak-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno05200  Pathways in cancer
rno05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    171333 (Il12rb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    171333 (Il12rb1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    171333 (Il12rb1)
   04659 Th17 cell differentiation
    171333 (Il12rb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    171333 (Il12rb1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    171333 (Il12rb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    171333 (Il12rb1)
   04090 CD molecules [BR:rno04090]
    171333 (Il12rb1)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL6/12 receptor family
   171333 (Il12rb1)
CD molecules [BR:rno04090]
 Proteins
  171333 (Il12rb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 171333
NCBI-ProteinID: NP_001164075
RGD: 620025
Ensembl: ENSRNOG00000019216
UniProt: E9PSU7
Position
16p14
AA seq 738 aa AA seqDB search
MDMTGLPGTSKHIIFLLLCQLSASSRGDSCCVEKISYPDEASGPSLGPRDLSCYRVSGTD
YECSWQYDGPEDNVAHFLWCCFAHPNPTHTSFGQECCCYFSSGRSRTVQFWEQDGISTLS
KVNFWVESRLGNRTLKSQEISQYLYNWTKLTPPLGHIRVSRSRGELRMDWNVSDGAGAEV
QLRRRMPTTNWTLGDCGPQVSSGLGVIGDIHGSSSESCLCPSENMAQEIQIRRRRRLSSG
APGGPWSNWSMSVCVPPEFLPQAEIKFLVEPLNQDGRRRLTMEGQTPQLAVPEGCRDRPG
AQVKKHLVLVHMLACRCQARTWKTVPLGKTLDLSGAAYDLDVLAQTRFGRSIIQKWPLPA
QELTETRTLNVIVEGNVTSMQWAAQPPGTAYCLEWQPWGQDRNHTDCTLIAPEEEDPAKM
VTHTWSSKPTLDQEECYRITVFASKNPKNPMMWATVLSSYYFGGNVSRVGTPRHVSVRNH
TEDSVSVEWTASQLSTCPGVLTQYVVRCEAEDGTWESELLVPPTKTQVTLNSLRSRVVYK
VQVRADTAMLPGSWSRPQRFSVEVQISRLSIVFASLGSFASVLLVGSLGYIGLNRAAWHL
CPPLPTPCGSTAVEFPGSQDKQAWQWRNPEDFPEVLYPRDALVVEMPRDRDDETESPQAT
PERALDTRWPLGTEGQVQGLSEARLPDLAREDCPRGDLAHVTLPLLLGDVTQGASVLGDL
WWIHKTVEPGPPTLGQEA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggacatgacggggctgccagggaccagcaagcacatcatcttcctcctgctttgccag
ctaagcgcctccagccgaggtgacagctgctgcgttgagaagatatcatacccagatgaa
gcctcaggcccctccttaggacccagggacttgagctgctacagggtttccgggacagac
tatgagtgctcctggcagtatgatggccctgaggacaatgttgctcacttcctgtggtgc
tgctttgctcatccaaaccctacccacaccagctttggccaagaatgctgctgctacttc
tcttcgggccggtctcggactgtgcagttctgggaacaggatggtatctctacgttgtcc
aaggtcaacttctgggtcgagtctcggcttgggaacaggaccttgaagtctcaggagata
tcgcagtacctgtacaactggaccaagctcacccctcctctgggacacatcagagtgtca
cgatcacgcggggagttgcgaatggactggaatgtgtcggatggggccggtgctgaggta
caactgaggcgccggatgcccacaacgaattggaccttgggtgactgcggacctcaggtt
agctctggcttaggtgtgattggtgacattcacggtagcagttctgagtcctgcctctgc
ccttctgagaacatggcccaggaaatccagatacggagacggcggcgcctctcctcagga
gctcctggaggtccctggagtaattggagcatgtctgtgtgtgtcccgcctgaattcctc
ccccaggctgagattaagttcctggtggagcccctgaaccaagatggaaggaggcgtctg
actatggaagggcagacaccacagctggcagtcccggagggctgcagggaccggcctggg
gcgcaggtgaagaagcacttggtgctggtgcacatgctggcctgcaggtgccaggctcgg
acctggaagaccgtgcccctgggcaagacgctggacctctccggtgccgcctacgacctg
gatgtactcgcccagactcgcttcggccgcagcatcatccagaagtggccccttcctgcc
caagagctcacagagacaagaaccctgaatgtcatcgtggaaggcaacgtgacatccatg
cagtgggcagcccagcctccaggcactgcctactgccttgagtggcagccatggggccag
gacaggaaccacacggactgtactctgattgcaccagaagaagaggacccagccaagatg
gtgacgcacacctggagctccaagcctaccctggaccaggaggaatgttaccgcatcact
gtcttcgcctccaagaaccccaagaatcccatgatgtgggccacggtcctgtccagttac
tactttgggggtaacgtctcaagggtcggaactccacgccacgtgtcggtgaggaaccac
accgaggactcagtgtccgtggagtggacagcgtcacagctgagcacctgcccaggggtc
ctgacgcaatacgtcgtgcgctgcgaggctgaagatggcacgtgggagtcagagttgctc
gtgccacccacgaagacccaagtgacactaaacagtctgcgcagccgcgtggtgtacaag
gttcaggtgcgagctgacactgcgatgctcccaggctcctggagccgtccccagcgcttc
agcgttgaggtgcagatttcccgtttatccatcgttttcgcgtctctgggaagcttcgcc
agcgtcctcctcgtgggcagtctcggatacattggcttaaacagggctgcctggcacttg
tgcccacctctgcctacgccctgtggcagcactgctgtggagttccctggcagccaggac
aagcaggcttggcaatggcgcaaccctgaggacttccccgaggtgttgtacccacgagac
gcgctggtggtggagatgcccagggacagagatgatgagacagagtcgccccaggccacc
cctgagcgcgccctggacacaaggtggcccttgggaactgaggggcaggtgcaaggactc
tcagaggccaggctcccggacctggctagagaggactgtccccgtggtgacctggcccac
gtgacactcccgctgctcctgggagatgtgacccagggagcctcggtacttggtgatctt
tggtggatccataagaccgtggagccaggaccacccactttgggtcaagaggcctga

DBGET integrated database retrieval system