KEGG   Rattus norvegicus (rat): 171339
Entry
171339            CDS       T01003                                 

Gene name
Dnah1, Dnahc1, RGD1311110
Definition
(RefSeq) dynein, axonemal, heavy chain 1
  KO
K10408  dynein heavy chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    171339 (Dnah1)
   05016 Huntington disease
    171339 (Dnah1)
   05022 Pathways of neurodegeneration - multiple diseases
    171339 (Dnah1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    171339 (Dnah1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     171339 (Dnah1)
SSDB
Motif
Pfam: AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy Dynein_AAA_lid AAA_lid_1 AAA_5 AAA_22 AAA_16 AAA_18 T2SSE DUF3450 DUF5798 SesA TBK1_CCD1
Other DBs
NCBI-GeneID: 171339
NCBI-ProteinID: NP_001028827
RGD: 621795
Ensembl: ENSRNOG00000026914
UniProt: Q63164 D3ZRN8
Position
16p16
AA seq 4250 aa
MEECDKEEASTSSQGPGYCPANVPENHDLEKMLKESSRNPEKTSPNPELKTPPLPLSDLG
QPRKSPLAGTDKKYPIMKQRGFYSDILSPGTLDQLGDVCCGPYLSQNLIRQADLDKFTPK
AESFVIPEDFQERVEQQSIGTTTRLLTQTDFPLQSYEPKVQVPFQVLPGRCPRKIEIERR
KQQYLRLDIEQLLANEGIDSNKLMPRHPDLQQPQTIEQGRDPLFPIYLPLKVFDNEEFDC
RTPTEWLNMGLEPDAQYRKPVPGKALLPTDDALGHEDPKSQELDYRWCEVGVLDYDEEKK
LYLVQKTDKRGLVRDEMGMPIVNGGVTPEGRPPLLDTQYWVPRIQLLFCAEDPRVFTQRV
VQANALRKNTEALLLYNLYVDCMPTEGQRVINEQSLSKIKQWALSTPRMRKGPSVLEHLS
SLAREVNLDYERSMNKINFDQIVSSKPETFSFVTLPEKEEEKVPNQGLVSVPEYPFREQK
EDFTFVSLLTRSEVITALSKVRAECNKVTSMSLFHSNLSKYSRLEEFEQIQSQTFSQVQM
FLKDSWISTLKVAMRSSLRDMSKGWYNLYETNWEVYLMSKLRKLMELIKYMLQDTLRFLV
QDSLGSFAQFIGDACCSVLECIDDMDWGEDLINSPYKPRKNPLFIVDLVLDNTGVHYSTP
LEQFEVILLNLFDKGILATHAVPQLEKLVMEDIFISGDPLLESVGLHEPLVEELRANITN
AMHKAMIPLQAYAKEYRKYLELNNNDISTFLKTYQTQCPSAEEVREVVITHLKEKEILDN
SLPSSIIIGPFYINVDNVKQSLSKKRKALATSMLDILAKNLHNEVDSICEEFRSISRKIY
EKPNSIEELAELRDWMKGIPEKLVILEERIVKVMSDYEVMDEFFYNLTTDDFNDKWAANN
WPTKILGQIDMVRQQHVEDEEKFRKIQLMDQNNFQEKLEGLQLVVAGFSTHVEIARAHEI
ANEVRRVKKQLKDCQQLAMLYNNRERIFGLPITNYDKLSRMVKEFQPYLDLWTTASDWLR
WSESWMNDPLSAIDAEQLEKNVIESFKTMHKCVKQFKDIPACQDVALDIRARIDEFKPYI
PLIQGLRNPGMRNRHWEVLSNEININVRPKANLTFARCLEMNLQDYIESISKVAEVAGKE
YAIEQALDKMEKEWASILFNVLPYKETDTYILKSPDEASQLLDDHIVMTQSMSFSPYKKP
FEQRINSWETKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDITRQLPVESKRYQTMERIWR
KIMKNAYENREVINVCSDQRLLDSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDE
LLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVKLSFSIYPSSNVE
DWLLEVERSMKASVHDIIEMAIKAYPTMLRTEWVLSWPGQVTIAGCQTYWTLEVAQALEA
SSISSSLFPQLSKQLSDLVALVRGKLSRMQRMVLSALIVIEVHAKDVVSKLIDENVVSVH
DFEWISQLRYYWTNNDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKF
GGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEF
NRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPD
NLKALFRPVAMMVPDYAMIAEISLYSFGFNEANVLAKKITTTFKLSSEQLSSQDHYDFGM
RAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTTKEE
ETDYGILDQAIRKACEKNNLKDVEGFLIKCIQLYETTVVRHGLMLVGPTGSGKSNCYRIL
AAAMTSLKGKPSISGGVYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFPSLIRAGA
IASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVA
SPATVSRCGMVYLEPSILGLMPFVECWLKHLPSIIKPYEEQFKTLFVKFLESSIAFVRTT
VKEVVASTNSNLTMSLLKLLDCFFKPFLPREGLKKIPSEKLSHIPELIEPWFIFSLVWSV
GATGDHSSRLNFSQWLKIKMVFEQIKLAFPEEGLVYDYRLDDAGISSTEDDDEDDEESKQ
VAWVKWMDYSVPFTMMPDTNYCNIIVPTMDTMQMSYLLGMLITNHKPVLCIGPTGTGKTL
TVSNKLLKNLPLEYISHFLTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDD
LNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNAITP
RLTRHFNYLSFIEMDEVSKKRIFSIILGCWMDGLLGEKSYREPVPGAPNIVHMTEPLVNA
TISIYAIITSQLLPTPAKSHYTFNLRDLSKVFQGILMAEPAKVEDKVQLLRLWYHENCRV
FRDRLVNEEDRGWFDGLLEMKMEDLGVAFNKVCPFQPILYGDFMSPGSDVKSYELITSEN
KMMQVIEEYMEDYNQINTAKLKLVLFVDAMSHICRISRTLRQALGNALLLGVGGSGRSSL
TRLASHMAEYECFQVELSKNYGMSEWREDVKKILLKAGMQNLPITFLFSDTQIKNESFLE
DINNILNSGDIPNLYSADEQDQIVNTMRPYIQEQGLQPTKANLMAAYTGRVRNNIHMVLC
MSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALQSVATRFLHEIPELECSSEVIEGLI
HVCVYIHQSVAKKCVEYLAELARHNYVTPKSYLELLNIFSILIGQKKMELKTAKHRMKSG
LDKLLRTSEDVAKMQEELEIMRPLLEEAAKDTLLTMDQIKVDTAIAEETRKSVQAEEIKA
NEKASKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAV
CIMKGIKPKKVPGEKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDKDNIGEAVIKAIQPY
IDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDDLEVTQRILE
EAKHHLREVEDGISTLQAKYRECVTKKEELEMKCEQCEQRLGRADKLINGLADEKVRWQD
TVENLENMLDNIFGDVLVAAGFVAYLGPFTGQYRAALYEYWVNQLTVYGVPHTSKPTLIS
TLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMEKESGLDV
FKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIP
YHEDFRMYITTKLPNPHYSPEVSTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQ
LIISNAKMRQELKDIEDQILYRLSSSEGNPVDDVELIKVLEASKMKAAEIQAKVRIAEQT
EKDIDLTRMEYIPVAVRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLK
KRIVNINRYLTFSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQGEWRYLLSGGSIQ
TMSENPAPHWLSDRAWRDILALSNLPAFSTFSTDFVQHLPKFQAIFDSAEPHREPLPGIW
NTYLDEFQKLLILRCLRGDKVTNAMQDFVANHLEPRFIEPQTANLSAVFKESNSTTPLIF
VLSPGTDPAADLYKFAEEMKFSKKLSAISLGQGQGPRAEAMMRNSIERGKWVFFQNCHLA
PSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVKANLLK
SYNSLSDDFLHSCQKVVEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICIS
QLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNPAVLSPEHRYSK
SGIYHQIPPTYDLNGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALFGAILQLQPK
SSSMGGQSREELVEDVAEDILVQVPKPVDLEEVVNKYPVLYEESMNTVLVQEVIRYNKLL
MVITQTLSDMLKAIKGLVVMSLELELMSTSLYNNAVPELWKSKAYPSLKPLASWIMDLLQ
RLNFLHSWIKNGIPSVFWISGFFFPQAFLTGTLQNFARKFVISIDTITFDFKVLSYASSE
IAERPSTGCYIYGLFLEGARWDPFDFQLAESRPKELYTEMAVIWLLPVANRKVQNQDFYL
CPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQRHWIKRGVALICALDY
NT seq 12753 nt   +upstreamnt  +downstreamnt
atggaggagtgtgataaagaagaagcgagcactagctctcagggcccaggatactgtcca
gcgaacgttcctgaaaatcatgacctggagaagatgttaaaagaatcaagccgtaatcca
gaaaagacttccccaaatcccgaactcaagaccccacctttacccctctcagacttaggg
cagcccaggaagtcgcctttggcaggcaccgataagaagtaccccatcatgaagcagcgt
ggattctattccgacatcctcagccctggaaccttagaccagcttggggatgtgtgctgt
gggccctacctgtcccagaatttgattcgtcaagccgacctcgacaagttcaccccaaaa
gctgaatcgttcgtcattcctgaggactttcaggagcgtgtagagcagcagagcatcggg
actaccacgcggctgctcacccagactgacttccctctacagtcctatgagcccaaggtg
caggtcccattccaggtgctgcccggacgttgccctcggaagattgagattgagaggagg
aaacagcagtatctacgcctggacattgagcagctgctggccaatgagggcattgactct
aacaagctcatgcccagacacccagacctgcagcaaccacaaaccatcgagcagggccgt
gacccactctttcccatttatctcccactgaaggtgtttgataatgaagagtttgactgc
cggactcccacagagtggctcaacatgggcttggagccagacgcacaatacaggaagccc
gtccccggaaaagcccttcttcccacagacgacgccctggggcacgaggaccccaagagt
caggaactggactacagatggtgtgaagttggtgtccttgactatgacgaagaaaagaaa
ctgtacttggtgcagaagactgacaagagaggcttggtgcgagatgagatggggatgccc
atcgtgaatggaggggtcacccctgaaggaaggccaccactcttggacacccagtactgg
gtcccgaggatccagctcctcttctgtgctgaggacccacgagtgttcacacagcgtgtg
gtccaggccaacgctctgcgcaagaacacagaggcgctgttgctctacaacctgtacgtg
gattgcatgcccacggaaggccagcgggtcatcaacgagcagagcttgagcaagataaaa
cagtgggctttgagcacaccacgcatgcgcaaggggccgagcgtcctggagcaccttagc
agcctggccagagaagtgaacctggactatgaacgcagcatgaacaagatcaactttgac
cagattgtctcttctaagccagagacattctcctttgtgactcttcctgaaaaagaggaa
gaaaaggtgcccaatcaagggctggtgagtgtccccgaataccccttccgggagcaaaag
gaggatttcactttcgtgtccctgctcactcggtcagaggtcatcacagctctgagcaaa
gtgcgggctgagtgcaacaaggtgacctccatgtccctgttccattccaacctctccaag
tacagccgcctggaggaatttgagcagatccagtctcaaaccttctcccaggtgcagatg
ttcctcaaggacagctggatcagcacactgaaagtagccatgcgcagcagcctccgggac
atgagcaagggctggtacaacctctacgagaccaactgggaggtgtacctcatgtcgaag
ctgcgcaagctgatggagctcatcaagtacatgctgcaggacacgctgcgcttcctggtg
caggactccctgggcagcttcgcacagttcatcggcgacgcctgctgcagtgtgcttgag
tgcatagacgacatggactggggcgaagacctcatcaacagtccctacaagccccggaag
aatcctctgttcatcgtagacttggtgctggacaacacgggggtgcactacagcacaccg
ctggagcagtttgaggtgattctgctcaacctctttgacaagggtatcctggccacccat
gctgtgccccaactggagaagctggtgatggaggacatctttatcagtggtgaccctctg
ctggagtcagtggggcttcacgagccactagtagaagagctacgtgctaacatcaccaat
gctatgcacaaggccatgataccactgcaggcctatgctaaggagtacagaaagtatctg
gagctgaacaacaacgacattagcaccttccttaagacctatcagactcagtgcccatca
gcagaggaggttcgggaagtggtaatcacccacctgaaagagaaggagatcctagacaac
tcattgcccagcagcatcatcattggtcccttctacatcaatgtcgacaacgttaagcag
agcctgtccaaaaaacgcaaggccctggccacttctatgctggatatcctagccaagaac
ttacacaacgaggtagacagtatctgcgaggagttccgcagcatcagccgcaagatctac
gagaagcccaacagcatcgaggagcttgccgagcttcgagactggatgaagggcatccct
gagaagctggtgattctggaggagcggatcgtaaaggtcatgtctgactacgaggtcatg
gatgaattcttttacaaccttaccactgacgacttcaatgacaagtgggctgccaacaac
tggcccacgaagatcctcgggcagatagatatggtgcggcaacagcatgttgaggatgag
gagaaattccgcaaaatccagctcatggaccagaacaacttccaggagaagctggaaggg
cttcagctggtggtggctggcttctccacccatgtggagattgcacgagcacacgagatt
gccaacgaggtgcggcgggtcaagaagcagctaaaggactgccagcagctggcgatgctg
tacaacaaccgcgagcgcatctttggcttgcctatcaccaactatgacaagctctcaaga
atggtgaaggaattccaaccctacctggacctctggaccacagcctcagactggctgcgc
tggtctgagagctggatgaacgatcctctgtcagccattgacgctgagcagctggagaag
aacgtcatcgagtcgttcaagaccatgcacaagtgcgtgaagcagttcaaggacatccca
gcctgccaggatgtggctttggatatccgagcacgcatagacgagttcaagccgtacata
ccgctgatccaaggcctgcgcaaccctggcatgcggaaccgccactgggaggtgctgtcc
aatgagatcaacatcaacgtcaggcccaaggccaacctgacctttgcccgctgccttgag
atgaaccttcaggactatattgagagtatcagcaaggtggctgaggtggctggcaaggag
tatgctattgaacaggcactagacaagatggagaaggaatgggcttccatcctgttcaac
gtgctgccctacaaggagacagacacttacatcctcaagagcccagatgaagcctcgcaa
ctgctcgatgaccacatcgtcatgactcagagcatgtctttttcaccgtacaagaaaccc
tttgagcagcgcatcaactcctgggagaccaaactgaagctgacccaggaggtgctagag
gagtggctgaactgccagaggtcctggctctacctggagcccatcttcagttctgaggac
atcacccggcagctgcccgtggagagcaagcgctaccaaaccatggagcggatctggagg
aagatcatgaagaatgcctatgaaaaccgggaggtaatcaatgtgtgctctgaccagagg
ctgctggacagcctcagggactgcaacaagttactggacctggtacagaagggcctcagc
gagtacctggagaccaagcggactgccttccccagattctacttcctgtcagatgatgaa
ctactggagatcctgtcacagacaaaggaccccacagccgtgcagccccacctgcgcaag
tgcttcgagaacattgcccggctgctgttccaggaggatttggagatcacacacatgtat
tcggcagagggggaagaggtgaagctgtccttctccatctacccctccagcaatgtggag
gactggctgctggaggtggagcgtagcatgaaggccagtgtgcacgacatcatcgagatg
gccatcaaggcctaccctacaatgctcagaactgagtgggttctgagctggccgggccag
gtgaccattgctggttgccagacatactggacattggaggtagcccaggcacttgaggcc
agcagcatcagtagcagcctcttcccccagctctccaaacagctcagtgacctggtggcc
ctcgtgcgggggaagttgtcccgcatgcagcggatggtgctgtcggcactcatcgtcatc
gaggtccacgccaaggacgtggtgagcaagctgattgacgagaacgtggtcagcgtacat
gactttgagtggatctcacagctcaggtactactggacaaataacgacctgtacatccgt
gctgtgaatgcggagttcatctacggctacgagtacctcggcaacagtgggaggctggtg
atcacacccctcactgacaggtgctatctgaccctgacaggagccttgcacctcaagttt
ggaggtgccccagctggcccagctggcacagggaaaacagagaccacaaaggacctgggg
aaggccttggccatacagacagttgtgttcaactgctccgaccagctcgacttcatggcc
atgggcaagttcttcaagggtctggccagtgcgggggcctgggcgtgctttgatgagttt
aatcggatcgacatcgaggtgctgtccgtggtggcacagcagatcaccaccatccagaaa
gcacagcagcagagggtggaacgcttcatgtttgagggtgttgaaatcccccttgtacca
tcctgtgctgtgtttatcaccatgaacccagggtatgctggccgcacagagctgcctgac
aatctgaaggccctcttccgacctgtggccatgatggtccccgattacgccatgattgct
gagatctcactctattcctttggcttcaatgaggccaatgtgctggctaagaagatcacc
accaccttcaagctgtcttctgagcagctcagctcccaggaccactatgatttcgggatg
agagccgtgaagactgtcatctcagcagccgggaaccttaagagagagaaccctaccatg
aatgaggagctgatctgccttcgggccatccgggatgtgaatgtacccaagttcctgcag
gaagacctcaagctcttctcggggattgtgtctgacctgttccctaccaccaaggaagag
gagaccgactatggcatcctggaccaggccatccgcaaggcctgtgagaaaaacaacctc
aaggatgtggagggcttcctgatcaagtgcatccagctgtacgagaccacagtggtacgg
cacggcctcatgcttgttggacccaccggctctggcaaaagtaattgttacagaatcctg
gcagctgccatgacatcgctgaaagggaagccatccattagtggtggcgtgtacgaagct
gtcaactactacgtgctcaaccccaagtccatcacaatgggtcagctgtatggggagttt
gacctgctcacccatgagtggacagatgggatcttcccctccctcatccgggctggtgcc
atcgcttctgacaccaataagaaatggtacatgtttgacgggccggtggatgctgtctgg
atcgagaacatgaacactgtgctggatgacaacaagaagctgtgcctcagctctggggag
atcatcaaactcacagaggcaatgaccatgatgttcgaggtgcaggacttggcagtggcc
tcgccagccacagtttctcgctgcggcatggtgtacctggagcccagcatcctagggctc
atgccattcgttgagtgctggctaaaacatctcccttccataataaagccctacgaggag
cagttcaagacactctttgtcaagttcctggagagctccatcgcctttgtccgaaccaca
gtgaaggaagtggttgcctcaacgaacagcaacctgaccatgagcctcctcaaactactc
gactgtttcttcaagcctttcctacccagagagggcctcaagaagataccgtctgaaaag
ctgagtcatatcccagagctgatagagccctggttcatcttctccctggtctggagtgta
ggcgccacaggagaccacagcagtcgcctcaacttcagccagtggctaaagataaagatg
gtgttcgaacagataaaactagctttcccagaagaagggctggtgtacgattaccgactg
gatgacgcagggatcagcagcactgaggatgacgatgaggacgatgaggagagcaaacag
gttgcctgggtaaagtggatggactactcggttccattcaccatgatgccagacaccaac
tactgcaacatcattgtgcccaccatggacaccatgcagatgtcctacctgctgggcatg
ctgatcaccaaccacaagcctgtgctgtgtatcgggccgacgggcacagggaagacgctc
acagtctctaacaaactcctcaagaacctgccactggaatacatcagccacttcctcacc
ttctcagcccgcacttcagccaaccagacccaggacctcattgacagcaagctggacaag
aggcgaaagggtgtgttcgggccacccctggggcgcaacttcatcttcttcattgacgac
ctgaacatgccagccctggagacgtacggcgcccagccacctattgagctgttgcgccag
tggatggaccatggtggctggtatgaccgaaagatcatcggagccttcaagaacctggtg
gatatcaactttgtctgtgccatgggtcccccagggggaggcaggaacgccatcactcca
aggctgacacgtcacttcaactacctgtctttcattgagatggatgaagtcagcaagaag
cgcatcttctctataatcctgggatgctggatggatggactccttggagagaaaagttac
cgagagcctgtgcctggggcccccaacatcgtccacatgacggagcccctcgtgaacgct
accatcagtatatatgctatcattacctcccagctgctgcccacaccagccaagtcccac
tatacctttaacctgagggacctgtccaaagtcttccagggaattctcatggctgaacca
gctaaggttgaggacaaggtgcagctgctgcggctgtggtaccatgagaactgccgtgtg
ttccgtgaccgcctagtgaatgaggaagatcgcggctggtttgatggtctccttgaaatg
aagatggaggatttgggggtggccttcaacaaagtttgtcccttccaacccattctttat
ggggacttcatgtccccaggctcagatgtaaagtcctacgagctcatcaccagtgagaat
aagatgatgcaggtgatcgaggagtacatggaggattacaaccagatcaacacagccaag
ctgaagctggtcctctttgtggatgccatgagccacatctgccgcatcagccgaaccctg
cgccaggctctgggcaacgcgctcctgttgggcgtgggtggcagtggccgcagctccctc
actcggctggcctcccacatggcggaatatgagtgcttccaggttgagctgtccaagaac
tacggcatgtctgagtggcgtgaagatgtcaagaagattctgctcaaggctggcatgcag
aacctgcccatcaccttcctgttctcagacactcagatcaagaacgagtccttcttggag
gacattaacaacatcctgaactcaggtgacatccccaacctctacagtgcagatgagcaa
gaccagatcgtcaacaccatgcggccctacatacaggagcagggcctgcagccgaccaaa
gccaatctcatggccgcctataccgggcgtgtgcgtaacaacatccacatggtgctgtgc
atgagtcccattggagaggtcttccgtgctcgcctgaggcagttcccctcacttgtcaac
tgctgcaccattgactggtttaacgagtggcccgcagaggccctgcaatctgtggccacc
aggttcctgcatgagatcccagaactggaatgttcgagtgaagtaattgaaggactgatt
cacgtttgcgtgtatatccaccagtccgtggccaagaaatgtgtcgagtacctggcagag
ctggcccgccacaactacgtgacccccaagagctatttggagctgctcaatattttctcc
atcctcattggacagaagaaaatggaactgaagacggccaaacaccgaatgaagagtggc
cttgacaagcttctgcgcacctcggaggatgtggccaagatgcaggaggagctggagatt
atgcgccccctgctggaagaagctgccaaggacaccttgctcactatggaccagatcaag
gtggacacagccatagctgaagagacccggaaatcagtgcaggcagaggagatcaaggcc
aacgagaaggccagcaaggcccaagctattgctgatgacgcccagaaggatctggatgag
gccctgccggccctggacgcagccctggccagccttcgaaacctcaacaagaatgatgtg
acagaggtgcgtgccatgcagcgcccacccccgggagtgaagctggtcatagaggccgtg
tgcatcatgaagggcatcaagcccaagaaggtacccggagagaaaccaggctccaaagtg
gatgactactgggagcccggcaaggggctgctgcaagacccaggccgcttccttgaaagc
ctcttcaagtttgacaaggacaacattggggaagcagttatcaaagccatccagccatac
atcgacaacgaggagttccaaccggccgccattgccaaggtgtccaaggcctgcacgtcc
atctgccagtgggtgcgcgccatgcacaagtaccactttgtagccaaggctgtggagccc
aaacggcaagccttgcgagaagcccaggacgacctggaagtcacccagaggatactagag
gaggcaaagcaccacctgcgcgaagtggaagatggcatctccacgctgcaggccaagtat
cgagagtgcgtgaccaagaaggaggagctggagatgaagtgtgagcagtgtgagcagcgc
ctaggccgggccgacaagctcatcaacgggctagcagacgaaaaggttcgctggcaggac
actgtggagaatctggagaatatgcttgacaacatttttggcgatgtgctggtggctgct
ggctttgtggcctacctggggcccttcacggggcagtaccgtgcagcgctctatgagtac
tgggtcaaccagctcacagtttacggtgtcccacacacctccaagcccacgctgatttca
accctgggaaaccccgtgaagatccgctcttggcagattgctggcctccccaatgacact
ctgtcagtggagaatggggtcatcaatcaattctcccagcgctggacccacttcattgac
cctcagggtcaggctaacaaatggatcaagaacatggagaaggagagtgggctagatgtg
ttcaagctgagtgaccgcgacttcctgcgcagcatggaaaacgctatccgctttggcaag
ccttgccttctggaaaatgtgggtgaggagctggatcccgcactggagcccgtgttgctt
aagcagacgtacaagcagcaagggaacacagtcctgaagttgggagacacagtgatcccc
taccatgaggacttcaggatgtacattaccaccaagctgcccaaccctcactattcacca
gaggtctccaccaaactcaccctcatcaactttacactgtcacccagtggcctagaggac
cagctactgggccaggtagtggccgaggaacggcctgatctggaagaggccaagaaccag
ctgattatcagtaatgccaagatgcggcaggagctaaaggacattgaggaccagatcctg
taccgcctcagctcctccgagggtaaccctgtggacgacgtggagcttatcaaggtgctg
gaggcttccaagatgaaggctgctgagatccaggctaaggtcaggattgcagagcagaca
gagaaggacattgacctcacgcgcatggagtacatacctgtggctgtccgcacccagatc
ctcttcttctgtgtgtcagacctggccaacgtggaccccatgtaccagtactctcttgag
tggttcctcaacatcttcctctcgggcatcgccaactcagagagagcagacaacctgaag
aagcgcatcgtcaacatcaaccgctacctaaccttcagcctctacagcaatgtctgccgc
agcctctttgagaagcacaagctgatgttcgccttcctgctgtgcgtccgtattatgatg
aatgagggcaagatcaaccagggtgagtggcgctaccttttgtctggaggctccatccag
accatgtctgagaaccctgccccacattggctctcagaccgggcctggagagacatcttg
gcactctcaaacctgccagccttttctaccttctctaccgacttcgtgcagcacctcccg
aaattccaggccatctttgacagtgctgagcctcacagggagcccttgcctggcatctgg
aacacatacctggacgagttccagaaactgcttattctccgttgcctgcgtggggataaa
gttactaatgccatgcaggactttgtggccaaccacctggaaccccgattcattgagccc
cagacagccaatctgtctgcagtgttcaaggagtccaactccacaacacccctcatcttt
gtgctgtcacctggtactgaccctgctgctgacctctataaatttgcagaagaaatgaag
ttttccaagaagctctctgccatctctttgggacagggtcagggccctcgggctgaagcc
atgatgcgcaactccatagagaggggcaagtgggtcttctttcagaactgccacttggca
ccaagctggatgccagccctggagcgtctcatcgagcacatcaatcctgacaaggtacac
cgggacttccgcttatggctcaccagcttgcccagtaataagttcccagtgtccatccta
caaaatggctccaaaatgactattgaaccgccacgtggcgtcaaagccaatctattgaag
tcctacaacagcctcagtgatgacttcctccactcctgtcaaaaggttgtggagttcaag
tccctgctgctatctctgtgtctgttccacggcaacgcacttgagcgccgtaagtttggg
cccctgggtttcaacatcccctatgagttcacagatggagacctgcgcatctgcatcagt
cagctcaagatgttcctagatgaatatgaggatatcccctacaaggttctcaagtacaca
gctggagagatcaactatggtggtcgcgtcactgacgactgggaccgacgctgtgtcatg
aacatactagaagacttctacaaccctgctgtgctctctccggagcacaggtacagcaaa
tccggcatataccaccagatcccacccacctatgacctcaatggctacctctcctacatc
aagagccttccactcaatgacatgcctgagatcttcggtctgcatgacaacgccaacatc
acctttgcccagaacgagacgtttgccttatttggtgccattctccagctgcagcccaaa
tcctcctccatgggtggccagagccgggaggagttagtggaagacgtggctgaggacatc
ctggtccaggtgcccaaacctgttgacctggaggaggtggtaaacaagtaccctgtactg
tatgaggagtcaatgaacacggtgctggtgcaagaggtcattaggtacaacaagctccta
atggtgatcacacagacactcagtgacatgctcaaggcaataaaggggctagtggtaatg
tccctggagctagagctgatgtccaccagcctgtacaacaacgctgtgcctgagctctgg
aaaagcaaggcctacccgtcgctcaagccactggcttcctggatcatggacctgctgcag
cgcctgaatttcctgcattcctggatcaaaaatggcatcccatctgtcttctggatcagt
ggcttcttcttccctcaggctttcctgacaggcactctacaaaactttgcccgaaagttc
gtcatctctatcgacactatcacctttgatttcaaggtactgtcctacgcatcatcagag
attgcggaaaggcccagtacggggtgctatatctacggactgttcctggaaggcgctcgc
tgggacccgttcgatttccagctggctgagtcccggcccaaagagctgtacacagagatg
gctgttatctggcttttgccagtagctaaccgaaaggtccagaaccaggacttctacctg
tgccccatctacaagactctgacccgtgctggaacattatcgactacaggccactcaacc
aactacgtcattgctgtagagatccccagcaaccagcctcagcgacactggataaagcgt
ggtgtagctctcatctgtgccctggactactag

DBGET integrated database retrieval system