KEGG   Rattus norvegicus (rat): 171375
Entry
171375            CDS       T01003                                 

Gene name
Atp5f1
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
  KO
K02127  F-type H+-transporting ATPase subunit b
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    171375 (Atp5f1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    171375 (Atp5f1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    171375 (Atp5f1)
   05012 Parkinson disease
    171375 (Atp5f1)
   05016 Huntington disease
    171375 (Atp5f1)
SSDB
Motif
Pfam: Mt_ATP-synt_B TraQ DUF4423 DUF2105 Lambda_Kil
Other DBs
NCBI-GeneID: 171375
NCBI-ProteinID: NP_599192
RGD: 620041
Ensembl: ENSRNOG00000046299
Vega: OTTRNOG00000000721
UniProt: P19511
Position
2q34
AA seq 256 aa
MLSRVVLSAAATAAPCLKNAAVLGPGVLQATRVFHTGQPRLAPLPPLPEYGGKVRLGLIP
EEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYVITPETFSTISVVGLIVYVIKKYGASI
GEFIDKLNEEKIAQLEEIKQSSMKQIQDAINREKAQQALVQKRHYLFDVQRNNIALALEV
TYRERLHKAYKEVKNRLDYHISVQDMMRRKEGEHMINWVEKHVIQSISAQQEKETIAKCI
GDLKMLAKKAQAQPIM
NT seq 771 nt   +upstreamnt  +downstreamnt
atgctgtcccgggtggtactttctgccgccgccacagcggccccgtgtctgaagaacgcg
gccgtcctgggtccaggggttttacaggcaacaagggtctttcacacaggacagcctcgc
cttgcccctctaccacctcttcctgaatatggaggaaaagtacgtcttgggctgattcct
gaggaatttttccagttcctttaccctaagactggtgtaacaggaccctacgtgcttgga
actgggcttagcttgtactttctatccaaagaaatatatgtgattaccccagagaccttc
tctaccatatcagtagtagggttgattgtctatgtgattaagaaatatggcgcctctatt
ggagaatttattgacaaacttaatgaggaaaaaattgctcaactagaagaaataaagcag
tcaagcatgaagcaaatccaggatgcaatcaacagggagaaggcacagcaggcactggtt
cagaagcgccactacctcttcgatgttcagaggaataacattgccctggccttggaggtc
acttaccgggaacgactacataaagcatataaggaggtaaagaatcgcctggactaccat
atttctgtacaggacatgatgcgtcgcaaggagggagagcacatgataaactgggtggag
aagcatgtgatacagagcatttctgcacagcaggaaaaggagaccattgccaagtgcatc
ggagatctaaagatgcttgcaaagaaggctcaagctcagccaattatgtga

DBGET integrated database retrieval system