KEGG   Rattus norvegicus (rat): 171379
Entry
171379            CDS       T01003                                 

Gene name
Smarca4, brg-1
Definition
(RefSeq) SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
  KO
K11647  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2/4 [EC:3.6.4.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04714  Thermogenesis
rno05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    171379 (Smarca4)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    171379 (Smarca4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    171379 (Smarca4)
   03036 Chromosome and associated proteins [BR:rno03036]
    171379 (Smarca4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     171379 (Smarca4)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     171379 (Smarca4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    171379 (Smarca4)
   PBAF complex
    171379 (Smarca4)
SSDB
Motif
Pfam: SNF2_N Helicase_C Bromodomain SnAC HSA BRK QLQ ResIII DEAD DUF2009
Other DBs
NCBI-GeneID: 171379
NCBI-ProteinID: NP_599195
RGD: 621728
Ensembl: ENSRNOG00000009271
UniProt: G3V790
Position
8q13
AA seq 1613 aa
MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPMPTQG
PGGYPQDNMHQMHKPMESMHEKGMPDDPRYNQMKGMGMRSGAHTGMGPPPSPMDQHSQGY
PSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGSDPQALGQQNRGPTPFNQNQLHQL
RAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGP
GPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQ
KLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPLVPLHQKQSRITPIQKPRG
LDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEV
VVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSIL
QHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRK
LIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIG
PDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEES
GSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGV
SQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADE
MGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAA
RRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTH
YVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEE
TILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTD
GSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASG
KFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLK
TFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVR
VLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEE
DEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAE
VERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKR
KRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYK
DSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQ
NAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVK
VKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSDEEQEEDRSGSGSEED
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgtctactccagacccacccctgggtggaacccctcggcctggtccttccccaggccct
ggtccttcacctggtgcaatgctgggtcctagccctggcccctcaccaggttctgcccac
agcatgatggggccaagcccaggacctccttcagcaggacatcccatgcccacccagggg
cctggagggtacccccaggacaacatgcatcaaatgcacaagcctatggagtccatgcac
gagaagggcatgcctgatgacccacgatacaaccaaatgaaagggatgggcatgcgatca
ggggcccacacaggtatgggacctccgcctagtcccatggaccagcattctcaaggttac
ccctcacccttaggtggctctgaacatgcctccagtcctgtcccggccagcggcccatct
tcaggccctcagatgtcctctgggccaggaggggccccactagatggttctgacccccag
gccttggggcagcaaaacagaggcccaaccccatttaaccagaaccagctgcatcaactc
agagctcagataatggcctataagatgttggccaggggccagccattgcccgaccacctg
cagatggccgttcaaggcaagcggccgatgcctggaatgcagcagcagatgccaacacta
cctccaccttcagtgtctgccacaggacctggacccggccctggccctggccctggccca
ggtccaggaccagcccctccgaattacagtagaccccatggtatgggagggcccaacatg
cctcctccaggaccctcaggtgtgccccccgggatgcctggtcagcctcctggagggcct
cccaagccatggcctgaaggacccatggccaatgctgctgcccccacaagcaccccacag
aagctgattcccccgcaaccaacaggccgcccttcacctgcacctcctgctgtcccgcct
gctgcctcacctgtaatgccaccacaaacacagtccccagggcagccagcccagcctgct
ccattggtgccattgcaccagaagcagagccgcatcacccccatccagaagccccggggc
ctggaccctgtggagatcctacaggagcgggagtacaggctgcaggctcgaatcgcacac
agaattcaggaacttgaaaacctccctgggtccctggctggggaccttcgaaccaaagca
accatcgaactcaaggcccttaggttgctgaacttccagaggcagctgcgccaggaggtg
gtggtgtgcatgcgaagagacacagccctagagacagccctcaatgccaaggcttataag
cgcagcaaacggcagtcactgcgggaggcccgcatcactgagaagctggagaagcagcag
aagattgaacaggaacgcaagcgtcgtcagaagcaccaggagtacctcaacagcattctg
cagcatgccaaggacttcagggagtatcacagatcagtcacaggcaaactccagaaactc
accaaggctgtggccacctaccatgccaacactgagcgggagcaaaagaaagaaaatgag
cgcatcgagaaggaacggatgcgaaggcttatggctgaagacgaggagggctaccgcaag
ctcattgaccagaagaaggacaagcgcctggcctacctcctgcagcagacagatgagtat
gtggccaacctcacagagctggtgcggcagcacaaagctgcccaggtagccaaggagaag
aagaagaaaaagaaaaagaagaaggcagaaaatgctgaagggcagacacctgccattgga
cccgacggtgagcctctggatgagaccagccagatgagtgacctccctgtgaaggtgatc
catgtggagagtggcaagatcctcactggcacagatgccccaaaagccgggcagctggaa
gcctggcttgagatgaacccagggtatgaagtagctcccagatcagatagtgaagaaagt
ggctctgaagaggaggaggaggaggaggaagaggagcagcctcagcccgcacagccccct
acactgcctgtggaagaaaagaagaagattccagacccagacagcgatgatgtctctgag
gtggacgctcgacacattattgagaacgccaagcaggatgtggacgatgagtacggcgtg
tcccaggcccttgctcgtggtctgcagtcctactatgctgtggcccatgcagtgacagag
agagtagataagcagtcagccctcatggtcaacggtgtcctcaaacagtaccagatcaag
ggtctggagtggctggtgtccctgtacaacaacaacctgaacggcatcctggctgatgag
atggggctggggaagaccatccaaaccattgcactcatcacgtacctcatggagcacaag
cgcatcaatgggcccttcctcatcatcgttcctctctcgacgctgtcaaactgggcatat
gaatttgacaagtgggccccctctgtggtgaaggtttcctacaagggctctccagctgcc
agacgagcttttgtcccccagcttcgcagcggcaagttcaatgtcttattgaccacctac
gagtatatcatcaaagacaaacatatcctggccaagatccgctggaagtacatgattgtg
gatgaaggccaccgcatgaagaaccaccactgcaaattgacacaggtccttaatacacac
tacgtggcccctcggcgcctgcttctcacaggcacgccactgcagaacaagctacctgag
ctctgggcactgctgaacttcctgctccccactatcttcaagagctgcagcaccttcgaa
cagtggttcaatgcaccctttgccatgactggagagaaggtggacctgaatgaggaggag
accatcctcattattcgtcgtctacacaaggtgctacggcccttcctgctgcggcgtctc
aagaaggaagttgaagcccagctccctgagaaggtagaatatgtcatcaaatgtgacatg
tcagccctgcagcgtgtgctctaccgtcacatgcaggccaaaggtgtgctgttgactgac
ggctctgagaaggacaagaagggcaaaggtggcaccaagacgctgatgaacactatcatg
cagctgcgcaagatctgcaaccacccctacatgttccagcacattgaggagtccttctct
gagcacctggggttcaccggtggcatcgtgcaaggattggacctatatcgtgcctcaggg
aaatttgaacttcttgatagaattctacccaaactccgtgcaacaaaccataaagtgcta
ctcttctgccaaatgacctccctcatgaccatcatggaagactactttgcataccgtggc
ttcaaatacctcaggcttgacggaaccacaaaagcagaagaccggggcatgctgttgaaa
acctttaatgagcctggctctgagtatttcattttcctactcagtacccgtgctgggggg
ctgggcctgaatctgcagtcagctgacactgtgatcatctttgacagtgactggaatcct
caccaggacctgcaagcacaggatcgtgcccatcggattgggcagcagaatgaggtgcgt
gtgcttcgcctgtgcaccgtcaacagtgtggaagagaagatactggctgctgctaaatac
aaactcaatgtggatcagaaggtcatccaggcaggcatgtttgaccagaagtcttccagc
catgagaggcgtgccttcctgcaggccatcctggagcacgaggagcaggacgaggaggaa
gatgaggtgcctgatgatgagaccgtcaaccagatgattgcccggcacgaagaagaattt
gacctcttcatgcgcatggacttggaccgccggcgtgaagaagcccgcaaccccaagcgg
aagccacgcctgatggaagaggatgagcttccatcctggatcatcaaggatgatgcagag
gtagagcggctgacatgtgaagaggaagaggaaaagatgttcggccgtggttctcgccac
cgcaaggaggtagactacagcgactcactgacagagaagcagtggctcaaggctatcgag
gagggcacgctggaggagatcgaagaggaggtccggcagaagaaatcttcacgtaagcgt
aagcgagacagcgaggccggctcctccaccccgaccaccagcacccgcagccgtgacaag
gacgaggagagcaaaaagcagaagaaacgtgggcggccacctgccgagaagctgtcccca
aacccacctaacctcaccaagaagatgaagaagatcgtggacgctgtgatcaagtacaaa
gacagtagtggacgtcagctcagtgaggtgttcattcagctcccctctcgcaaggaactt
cctgagtactatgagctcatccggaaacctgtggacttcaagaagatcaaggaacgcatc
cgaaaccacaagtaccgcagcctcaatgacctggagaaggacgtgatgttgctgtgccag
aatgctcagaccttcaacctcgagggctccctgatctacgaggactccatcgtcctgcag
tctgtcttcaccagcgtgcggcagaaaatcgagaaggaggatgacagtgaaggcgaggaa
agcgaggaggaagaagagggcgaggaggaaggctctgagtctgagtcccgctctgtcaag
gtaaagatcaagctgggtcgaaaggagaaggcccaggaccgactcaaggggggcaggcgg
cggccaagccgggggtcccgggccaagcctgtcgtgagtgacgatgacagtgatgaggag
caggaggaggaccgctcaggaagtggcagcgaggaagactga

DBGET integrated database retrieval system