KEGG   Rattus norvegicus (rat): 171458
Entry
171458            CDS       T01003                                 

Gene name
Ipmk, Impk, Ipk2
Definition
(RefSeq) inositol polyphosphate multikinase
  KO
K00915  inositol-polyphosphate multikinase [EC:2.7.1.140 2.7.1.151]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
Module
rno_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    171458 (Ipmk)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    171458 (Ipmk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.140  inositol-tetrakisphosphate 5-kinase
     171458 (Ipmk)
    2.7.1.151  inositol-polyphosphate multikinase
     171458 (Ipmk)
SSDB
Motif
Pfam: IPK
Other DBs
NCBI-GeneID: 171458
NCBI-ProteinID: NP_599244
RGD: 620954
Ensembl: ENSRNOG00000000609
UniProt: Q99NI4
Position
20p11
AA seq 396 aa
MAAEPPALRLRPPGSTGDSPPVPRLLGGCVPLSHQVAGHMYGKDKVGILQHPDGTVLKQL
QPPPRGPRELEFYTMVYAADCADAVLLELRKHLPKYYGVWSPPSAPNDVYLKLEDVTHKF
NKPCIMDVKIGRKSYDPFASAEKIQQQVSKYPLMEEIGFLVLGMRVYHLHSDSYETQNQH
YGRGLTKETLKEGVSKFFHNGFCLRKDAVAASIQKVEKILQWFENQKQLNFYASSLLFVY
EGSSQPATTKSNDRTLAGRFLSKGALSDADVLECNNNFHLFSSPANGTSVGKSLSKAYSR
HRKLYAKKHQSQTSLKVETLEQDNGWKSMSQEHLNGNVLSQLEKVFYHLPAGRQEIAEAE
VRMIDFAHVFPSNTVDEGYVYGLKHLIAVLRSILDS
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggccgccgagcccccagcgctgcgcctgcggccgcctggaagcaccggagacagcccg
ccggtgccgcgcctgctcggaggctgcgtgccgctgtcgcatcaggtggctggccacatg
tacggcaaggacaaagtgggcatactccagcacccagatggtacagttctgaaacagctg
cagccaccgcctcggggcccaagagagctggaattttataccatggtttacgctgctgac
tgtgccgatgctgttctcctggagctgcggaaacacctgcccaagtactatggcgtctgg
tcccctcccagcgcacccaacgatgtgtacctaaaactggaagatgtgactcataagttt
aacaagccctgtataatggacgtgaagattgggcggaagagctacgacccctttgcctcg
gcagagaagattcagcagcaggtcagcaagtaccctctgatggaggagatcgggttcctg
gtgctcggcatgagggtttatcatcttcactctgacagctacgagacacaaaaccagcac
tatggaagaggcctgacgaaagagactctgaaggagggtgtctccaagtttttccacaac
ggcttctgtttaaggaaagacgcggtggcagccagtattcagaaggtcgagaagattctc
cagtggtttgaaaatcagaagcagcttaacttttatgcaagctctttactgtttgtttat
gaaggttcatctcagccagctaccacaaaatcaaacgatagaactttggcggggaggttt
ctctccaaaggagccctgtcggacgcggatgtactagagtgcaataacaacttccacctg
ttcagctccccggccaacggcacgtcagtgggcaaaagcttatctaaggcgtactcgagg
cacagaaagctgtatgcaaaaaagcaccagagtcagacttccctcaaagttgaaactcta
gagcaagacaacgggtggaaaagcatgtcccaggaacacttaaacggaaacgtgctttcc
caactggaaaaggtgttctaccaccttccggcgggccggcaggagatcgcggaagcggaa
gtgcggatgatagactttgctcacgtgttccctagcaacacagtagatgaggggtatgtt
tacggtctgaagcatctaattgccgtgcttcggagtatcttggacagttga

DBGET integrated database retrieval system