KEGG   Rattus norvegicus (rat): 192203
Entry
192203            CDS       T01003                                 

Gene name
Fap
Definition
(RefSeq) fibroblast activation protein, alpha
  KO
K08674  fibroblast activation protein, alpha [EC:3.4.21.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    192203 (Fap)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     192203 (Fap)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   192203 (Fap)
SSDB
Motif
Pfam: DPPIV_N Peptidase_S9 Abhydrolase_6 Peptidase_S15 DPPIV_rep DLH LIP Arm-DNA-bind_2 Esterase_PHB PD40
Other DBs
NCBI-GeneID: 192203
NCBI-ProteinID: NP_620205
RGD: 621253
Ensembl: ENSRNOG00000005679
UniProt: Q8R492
Position
3q21
AA seq 761 aa
MKTWLKTVFGVTTLVALALVVICIVLRPSRVYSPEGNTGRSLTLKDILNGTFSYKTYFPN
WISEQEYLHQSEDDNIVFYNIETRESYIILSNSTMKSVNATDYGLSPDRQFIYLESDYSK
LWRYSYTATYYIYDLQNGEFVRGYELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPP
FQITYTGRENRIFNGIPDWVYEEEMLATKYALWWSPDGKYLAYVEFNDSDIPIIAYSYYG
DGQYPRTINIPYPKAGAKNPIVRVFIVDTIYPHHVGPIEVPVPEMIASSDYYFTWLTWVT
NERVCLQWLKRVQNVSVLSICDFREDWHAWDCPKNQEHIEESRTGWAGGFFVSTPAFSQD
AASYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEAIYIFRVTQDSLFYSSNEFEGYPG
RRNIYRISIGNSPPSKKCVTCHLRKERCQYYTASFSYKAKYYALICYGPGLPISTLHDGR
TDQEIQVLEENKELENALRNIQLPAVEIKKLEDGGMTFWYKMILPPQFDRSKKYPLLIQV
YGGPCSQSVKSVFSVNWITYLASKEGIVVALVDGRGTAFQGDKFLHAVYRKLGVYEVEDQ
LTAVRKFIEMGFIDEGRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASIY
TERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNA
QVDFQAMWYSDQNHGISSGRSQNHLYTHMTHFLKQCFSLSD
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgaagacatggctgaaaaccgtctttggagtcactactttggttgcgcttgctctagtg
gtgatatgcattgtcttacgtccctcaagagtttacagccctgaaggcaacacaggaaga
tctcttaccctgaaggatattttaaatggaacattctcctataaaacatattttccaaac
tggatttcagagcaagaatatcttcatcaatctgaggatgataacatagtcttttataat
attgaaacaagagaatcctatatcattttgagtaatagcaccatgaaaagtgtgaatgct
acagactatggcctgtcacctgatcggcagtttatatatcttgaaagtgattattcaaag
ctctggcgatattcatacacagcgacatactacatctacgaccttcagaatggggaattt
gtaagaggatacgagctccctcgtccaattcagtatctgtgctggtctcccgttgggagt
aaattagcatatgtctatcaaaacaatatttatttaaaacaaagaccaggagatccacct
tttcaaataacttacactggaagagaaaatagaatatttaatggaattccagactgggtt
tatgaagaggaaatgcttgctacaaaatatgccctttggtggtccccagatggaaaatat
ttggcatatgtagaatttaatgattcggacataccaattattgcctactcgtattatggc
gatggacagtatcctagaactataaatattccatacccgaaggccggagctaagaatccc
attgttcgtgtctttattgttgacactatctacccacaccatgtgggtcctatagaagta
ccagttccagagatgatagcctcgagtgactactatttcacctggctcacatgggtgacc
aacgaacgagtatgtttgcagtggctaaagagagtgcagaatgtctcagtcttgtctata
tgtgatttcagagaagactggcatgcgtgggattgtccaaagaaccaggagcatattgaa
gaaagcagaacaggatgggctggtggattctttgtttccacaccagcttttagccaggat
gccgcttcatactacaaaatatttagcgacaaggatggttacaaacatattcactacatc
aaagacactgtggaaaatgctattcaaattacaagtggcaagtgggaggccatatatata
ttccgagtaacacaggattcactgttttattctagcaatgaatttgaaggttaccctgga
agaagaaacatctacagaattagcattggaaactctcctccgagtaagaagtgtgttact
tgccatctaaggaaagaaaggtgccaatattacacagcaagtttcagctacaaagccaaa
tactatgcactcatctgctacggccctggcctcccgatttccaccctccatgatggccgc
acagaccaagaaatacaagtattagaagagaacaaagaactggagaacgctctgagaaac
atccagctgcctgcagtggaaattaagaagcttgaagacggtggaatgactttctggtac
aagatgattcttcctcctcagtttgacagatcaaagaagtaccctctgctaattcaagtg
tatggtggtccctgcagccagagtgtaaagtctgtattctctgttaattggataacttat
cttgcaagtaaagaggggatagtcgttgccttggtagatggccggggcactgctttccaa
ggtgacaaattcctgcatgccgtgtatcgaaagctgggtgtgtatgaagttgaggaccag
ctcacagctgtcagaaaattcatagaaatgggtttcattgatgaaggaagaatagccata
tggggatggtcctacggaggttatgtttcatccctagcccttgcgtccggaactggcctt
ttcaaatgtggtatagcagtggctccagtctccagctgggaatactacgcctctatctac
acggagagattcatgggcctcccaacaaaggatgataatcttgaacactataaaaattca
actgtgatggcaagagcagaatatttcagaaatgtagactatcttctcatccacggaaca
gcagatgataatgtgcactttcagaactcagcacagattgctaaagctttggttaacgca
caagtggatttccaggcgatgtggtactctgaccagaaccatggcatatcatctgggcgc
tcccagaaccacttatacactcacatgacgcacttcctcaagcaatgcttttctttatca
gactga

DBGET integrated database retrieval system