KEGG   Rattus norvegicus (rat): 192277
Entry
192277            CDS       T01003                                 

Gene name
Stip1
Definition
(RefSeq) stress-induced-phosphoprotein 1
  KO
K09553  stress-induced-phosphoprotein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05020  Prion disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    192277 (Stip1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    192277 (Stip1)
Chaperones and folding catalysts [BR:rno03110]
 Other chaperones and cochaperones
  Sti1 / p60
   192277 (Stip1)
SSDB
Motif
Pfam: TPR_1 TPR_2 STI1 TPR_11 TPR_8 TPR_12 TPR_14 TPR_16 TPR_17 TPR_19 TPR_7 TPR_9 NARP1 ANAPC3 TPR_3 MIT Paf67 TPR_MalT
Other DBs
NCBI-GeneID: 192277
NCBI-ProteinID: NP_620266
RGD: 621599
Ensembl: ENSRNOG00000021164
UniProt: O35814
Position
1
AA seq 543 aa
MEQVNELKEKGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYED
GCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNLQLKEGLQNMEARLA
ERKFMNPFNLPNLYQKLENDPRTRTLLSDPTYRELIEQLQNKPSDLGTKLQDPRVMTTLS
VLLGVDLGSMDEEEEAATPPPPPPPKKEAKPEPMEEDLPENKKQALKEKELGNDAYKKKD
FDKALKHYDKAKELDPTNMTYITNQAAVHFEKGDYNKCRELCEKAIEVGRENREDYRQIA
KAYARIGNSYFKEERYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLA
LEEKNKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEEC
IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHD
SPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLI
AIR
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggagcaggtgaatgagctaaaggagaagggcaataaggccctgagtgctgggaacatt
gatgatgccttacagtgctactctgaggcaattaaactagatcctcagaaccatgtgctc
tatagcaatcgctctgcagcctatgccaagaaaggagactaccagaaggcgtatgaggac
ggttgcaagactgttgacctgaagcctgactggggcaagggttattcaagaaaagcagca
gcccttgagttcctaaaccggtttgaagaagccaaacgaacctatgaagaaggtttaaaa
catgaagccaataatctacagcttaaggaaggcttgcagaacatggaggccaggttggca
gagaggaaatttatgaatcctttcaacttgcctaatctgtaccagaagttagagaatgat
cccaggacaaggacactgctcagtgaccccacctacagggaactcatagagcaactacag
aacaagccttcagacctgggcacgaaactccaagatccccgggtcatgactactctcagt
gtcctccttggagttgatctgggcagtatggatgaagaggaagaggcagcaacaccccca
cctccaccccctcctaaaaaggaggccaagccagaaccaatggaagaagatcttccagag
aataagaaacaggctctgaaagaaaaggagctgggaaatgatgcctacaagaagaaagat
tttgacaaggccctgaagcattatgacaaggccaaggagctggaccctaccaatatgact
tacataactaatcaagcagctgtgcactttgagaagggcgactacaacaaatgccgggag
ctctgtgagaaggccattgaagtaggcagagagaaccgagaggactaccgtcagatcgcc
aaagcttatgctcgaattggcaattcctatttcaaagaagaaaggtacaaggatgctatc
catttctacaacaagtctctggcagagcaccgaaccccagatgtgctcaagaagtgccag
caggcagagaaaattctgaaggaacaagagcgactggcttatatcaaccctgatttggct
ttggaggaaaagaataagggcaatgagtgcttccagaaaggggactacccccaggccatg
aagcactatacagaagccattaaaaggaacccaagagatgccaaactatacagcaaccga
gccgcctgctacaccaagctcctggagtttcagctggcactcaaggactgtgaagagtgc
atccagctagagccaaccttcatcaagggttatacacggaaagcagctgccctggaagcc
atgaaggactatacaaaagccatggatgtgtaccagaaggcattagacctggactccagc
tgtaaggaagcagcagatggttaccaacgctgtatgatggcacagtacaacagacatgat
agccctgaggatgtgaaacggcgggccatggctgaccctgaggtacagcagataatgagt
gacccagccatgaggctcatcctggagcagatgcaaaaggacccccaagctctgagcgaa
cacttaaagaatcctgtaatagcacagaagatccagaagctgatggatgtgggtctgatc
gcaattcggtga

DBGET integrated database retrieval system